DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sauerwald-2013-1 human Homo sapiens Human tem transmission electron microscopy tem predetermined predetermined participant predetermined Sauerwald A., Sandin S., Cristofari G., Scheres SH., Lingner J., Rhodes D. DIP original experiment: DIP-253008X Nature structural & molecular biology 2013 IMEx Structure of active dimeric human telomerase. Sauerwald A., Sandin S., Cristofari G., Scheres SH., Lingner J., Rhodes D. Only protein-protein interactions imex curation sauerwald-2013-2 human Homo sapiens Human pull down pull down predetermined predetermined participant predetermined Sauerwald A., Sandin S., Cristofari G., Scheres SH., Lingner J., Rhodes D. DIP original experiment: DIP-253006X Nature structural & molecular biology 2013 IMEx Structure of active dimeric human telomerase. Sauerwald A., Sandin S., Cristofari G., Scheres SH., Lingner J., Rhodes D. Only protein-protein interactions imex curation sauerwald-2013-3 human Homo sapiens Human 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Sauerwald A., Sandin S., Cristofari G., Scheres SH., Lingner J., Rhodes D. DIP original experiment: DIP-253009X Nature structural & molecular biology 2013 IMEx Structure of active dimeric human telomerase. Sauerwald A., Sandin S., Cristofari G., Scheres SH., Lingner J., Rhodes D. Only protein-protein interactions imex curation sauerwald-2013-4 human Homo sapiens Human density sedimentation cosedimentation through density gradient density sedimentation de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Sauerwald A., Sandin S., Cristofari G., Scheres SH., Lingner J., Rhodes D. DIP original experiment: DIP-253007X Nature structural & molecular biology 2013 IMEx Structure of active dimeric human telomerase. Sauerwald A., Sandin S., Cristofari G., Scheres SH., Lingner J., Rhodes D. Only protein-protein interactions imex curation tert_human Telomerase reverse transcriptase TERT EST2 TCS1 TRT Telomerase catalytic subunit HEST2 Telomerase-associated protein 2 protein protein human Homo sapiens Human MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPWDARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVRSYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNLRKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD dkc1_human H/ACA ribonucleoprotein complex subunit DKC1 Dyskerin Nucleolar protein family A member 4 snoRNP protein DKC1 Nopp140-associated protein of 57 kDa Nucleolar protein NAP57 CBF5 homolog DKC1 NOLA4 protein protein human Homo sapiens Human MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDKHGKPTDSTPATWKQEYVDYSESAKKEVVAEVVKAPQVVAEAAKTAKRKRESESESDETPPAAPQLIKKEKKKSKKDKKAKAGLESGAEPGDGDSDTTKKKKKKKKAKEVELVSE nop10_human H/ACA ribonucleoprotein complex subunit 3 NOLA3 NOP10 Nucleolar protein family A member 3 snoRNP protein NOP10 Nucleolar protein 10 protein protein human Homo sapiens Human MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL tert-1 3251702 N/A 3251706 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false tert-tert-1 3251703 N/A 3251706 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3251706 unspecified role unspecified role bait bait ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false tert-4 3251704 N/A 3251706 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false dkc1-nop10-1 3251705 N/A 3251707 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3251708 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3251706 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false