DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kershaw-2013-1 in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. DIP original experiment: DIP-253002X Nature structural & molecular biology 2013 IMEx SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. Only protein-protein interactions imex curation kershaw-2013-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. DIP original experiment: DIP-252999X Nature structural & molecular biology 2013 IMEx SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. Only protein-protein interactions imex curation kershaw-2013-3 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. DIP original experiment: DIP-253001X Nature structural & molecular biology 2013 IMEx SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. Only protein-protein interactions imex curation kershaw-2013-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. DIP original experiment: DIP-253004X Nature structural & molecular biology 2013 IMEx SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. Only protein-protein interactions imex curation kershaw-2013-5 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. DIP original experiment: DIP-253000X Nature structural & molecular biology 2013 IMEx SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. Only protein-protein interactions imex curation kershaw-2013-6 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. DIP original experiment: DIP-253003X Nature structural & molecular biology 2013 IMEx SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. Only protein-protein interactions imex curation il6rb_mouse Interleukin-6 receptor subunit beta Il6st Interleukin-6 signal transducer Membrane glycoprotein 130 Oncostatin-M receptor subunit alpha protein protein mouse Mus musculus Mouse MSAPRIWLAQALLFFLTTESIGQLLEPCGYIYPEFPVVQRGSNFTAICVLKEACLQHYYVNASYIVWKTNHAAVPREQVTVINRTTSSVTFTDVVLPSVQLTCNILSFGQIEQNVYGVTMLSGFPPDKPTNLTCIVNEGKNMLCQWDPGRETYLETNYTLKSEWATEKFPDCQSKHGTSCMVSYMPTYYVNIEVWVEAENALGKVSSESINFDPVDKVKPTPPYNLSVTNSEELSSILKLSWVSSGLGGLLDLKSDIQYRTKDASTWIQVPLEDTMSPRTSFTVQDLKPFTEYVFRIRSIKDSGKGYWSDWSEEASGTTYEDRPSRPPSFWYKTNPSHGQEYRSVRLIWKALPLSEANGKILDYEVILTQSKSVSQTYTVTGTELTVNLTNDRYVASLAARNKVGKSAAAVLTIPSPHVTAAYSVVNLKAFPKDNLLWVEWTPPPKPVSKYILEWCVLSENAPCVEDWQQEDATVNRTHLRGRLLESKCYQITVTPVFATGPGGSESLKAYLKQAAPARGPTVRTKKVGKNEAVLAWDQIPVDDQNGFIRNYSISYRTSVGKEMVVHVDSSHTEYTLSSLSSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSKSHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANNKKPCPDDLKSVDLFKKEKVSTEGHSSGIGGSSCMSSSRPSISSNEENESAQSTASTVQYSTVVHSGYRHQVPSVQVFSRSESTQPLLDSEERPEDLQLVDSVDGGDEILPRQPYFKQNCSQPEACPEISHFERSNQVLSGNEEDFVRLKQQQVSDHISQPYGSEQRRLFQEGSTADALGTGADGQMERFESVGMETTIDEEIPKSYLPQTVRQGGYMPQ jak2_mouse Tyrosine-protein kinase JAK2 Janus kinase 2 Jak2 protein protein mouse Mus musculus Mouse MGMACLTMTEMEATSTSPVHQNGDIPGSANSVKQIEPVLQVYLYHSLGQAEGEYLKFPSGEYVAEEICVAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHDILYRIRFYFPHWYCSGSSRTYRYGVSRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLGMAVLDMMRIAKEKDQTPLAVYNSVSYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEQFEVKESARGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDVQLYCDFPDIIDVSIKQANQECSNESRIVTVHKQDGKVLEIELSSLKEALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIHSNCHGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENGEYNLSGTKRNFSNLKDLLNCYQMETVRSDSIIFQFTKCCPPKPKDKSNLLVFRTNGISDVQISPTLQRHNNVNQMVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHKTEVLLKVLDKAHRNYSESFFEAASMMSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLGVAKQLAWAMHFLEEKSLIHGNVCAKNILLIREEDRRTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDKHQLPAPKWTELANLINNCMDYEPDFRPAFRAVIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPVEFMRMIGNDKQGQMIVFHLIELLKSNGRLPRPEGCPDEIYVIMTECWNNNVSQRPSFRDLSLRVDQIRDSIAA socs3_mouse Suppressor of cytokine signaling 3 Cytokine-inducible SH2 protein 3 Protein EF-10 Cis3 Cish3 Socs3 protein protein mouse Mus musculus Mouse MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL eloc_mouse Elongin-C Eloc Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 Stromal membrane-associated protein SMAP1B homolog Tceb1 Transcription elongation factor B polypeptide 1 protein protein mouse Mus musculus Mouse MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC q15370-1 Elongin-B ELOB TCEB2 Elongin 18 kDa subunit RNA polymerase II transcription factor SIII subunit B SIII p18 Transcription elongation factor B polypeptide 2 protein protein human Homo sapiens Human MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ il6st-jak2-1 3251482 n/a 3251488 unspecified role unspecified role unspecified role unspecified role Region 750-764 Region 750-764 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 3251489 unspecified role unspecified role unspecified role unspecified role Region 836-1132 Region 836-1132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3251490 unspecified role unspecified role unspecified role unspecified role Region 22-185 Region 22-185 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false il6st-jak2-2 3251483 n/a 3251488 unspecified role unspecified role unspecified role unspecified role Region 750-764 Region 750-764 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 3251489 unspecified role unspecified role unspecified role unspecified role Region 836-1132 Region 836-1132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3251490 unspecified role unspecified role unspecified role unspecified role Region 22-185 Region 22-185 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false il6st-jak2-3 3251484 n/a 3251488 unspecified role unspecified role unspecified role unspecified role Region 750-764 Region 750-764 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 3251489 unspecified role unspecified role unspecified role unspecified role Region 836-1132 Region 836-1132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3251490 unspecified role unspecified role unspecified role unspecified role Region 22-185 Region 22-185 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false jak2-elob-1 3251485 N/A 3251491 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3251492 unspecified role unspecified role prey prey ecolx Escherichia coli n/a 3251489 unspecified role unspecified role bait bait Region 836-1132 Region 836-1132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3251490 unspecified role unspecified role prey prey O35718:p.Phe25Ala F25A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Region 1-24 Region 1-24 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false Deletion of region 1-23 decreased the interaction rate/strength. il6st-jak2-4 3251486 n/a 3251488 unspecified role unspecified role unspecified role unspecified role Region 750-764 Region 750-764 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 3251489 unspecified role unspecified role unspecified role unspecified role Region 836-1132 Region 836-1132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3251490 unspecified role unspecified role unspecified role unspecified role Region 22-185 Region 22-185 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false jak2-elob-2 3251487 N/A 3251491 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3251492 unspecified role unspecified role prey prey ecolx Escherichia coli n/a 3251489 unspecified role unspecified role bait bait Region 836-1132 Region 836-1132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q62120:p.Gly1071Asp G1071D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3251490 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false