DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ shi-2013-7 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252176X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions imex curation shi-2013-8 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252174X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions imex curation shi-2013-9 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252178X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions imex curation shi-2013-10 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252179X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions imex curation shi-2013-11 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252183X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions imex curation shi-2013-12 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252177X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions imex curation shi-2013-13 in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252175X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions imex curation shi-2013-14 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252181X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions imex curation shi-2013-15 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252184X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions imex curation shi-2013-16 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252182X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions imex curation shi-2013-17 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252180X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions imex curation q9p289-1 Serine/threonine-protein kinase 26 STK26 MASK MST4 MST3 and SOK1-related kinase Mammalian STE20-like protein kinase 4 Serine/threonine-protein kinase MASK protein protein human Homo sapiens Human MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP cab39_human Calcium-binding protein 39 CAB39 CGI-66 MO25alpha MO25 Protein Mo25 protein protein human Homo sapiens Human MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA cab39-stk26-1 3251115 N/A 3251126 unspecified role unspecified role unspecified role unspecified role Region 18-297 Region 18-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3251127 unspecified role unspecified role unspecified role unspecified role Region 11-334 Region 11-334 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cab39-stk26-2 3251116 N/A 3251126 unspecified role unspecified role unspecified role unspecified role Region 18-297 Region 18-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3251127 unspecified role unspecified role unspecified role unspecified role Region 11-334 Region 11-334 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false stk26-cab39-1 3251117 N/A 3251126 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3251127 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9Y376:p.Phe178Glu F178E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9Y376:p.Tyr223Ala Y223A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9Y376:p.Arg227Ala R227A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9Y376:p.Met260Glu M260E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9Y376:p.[Phe178Glu;Val224Glu] F178E/V224E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false cab39-stk26-3 3251118 N/A 3251126 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9P289-1:p.Glu58Ala E58A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Leu95Glu L95E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Tyr134Ala Y134A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Trp324Glu W324E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.[Leu90Glu;Leu95Glu] L90E/L95E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3251127 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false stk26-cab39-2 3251119 N/A 3251126 unspecified role unspecified role bait bait Region 18-297 Region 18-297 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Leu95Glu L95E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Tyr134Ala Y134A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Trp324Glu W324E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.[Leu90Glu;Leu95Glu] L90E/L95E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Glu138Ala E138A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3251127 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false stk26-cab39-3 3251120 N/A 3251126 unspecified role unspecified role bait bait Region 1-297 Region 1-297 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Asp162Ala D162A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3251127 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false cab39-stk26-4 3251121 N/A 3251126 unspecified role unspecified role unspecified role unspecified role Region 18-297 Region 18-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3251127 unspecified role unspecified role unspecified role unspecified role Region 11-334 Region 11-334 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cab39-stk26-5 3251122 N/A 3251126 unspecified role unspecified role unspecified role unspecified role Region 323-327 Region 323-327 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3251126 unspecified role unspecified role unspecified role unspecified role Region 18-297 Region 18-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3251127 unspecified role unspecified role unspecified role unspecified role Region 11-334 Region 11-334 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false cab39-stk26-6 3251123 N/A 3251126 unspecified role unspecified role prey prey Q9P289-1:p.[Asp242Ala;Lys276Ala] D242A/K276A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Phe229Ala F229A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Leu228Glu L228E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Met225Glu M225E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3251127 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false Deletion of region 222-233 decreased the interaction rate/strength. stk26-cab39-4 3251124 N/A 3251126 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3251127 unspecified role unspecified role prey prey Q9Y376:p.Phe178Glu F178E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9Y376:p.Tyr223Ala Y223A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9Y376:p.Arg227Ala R227A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9Y376:p.Met260Glu M260E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9Y376:p.[Phe178Glu;Val224Glu] F178E/V224E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false stk26-stk26-1 3251125 N/A 3251126 unspecified role unspecified role prey prey Region 1-327 Region 1-327 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3251126 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-327 Region 1-327 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Met225Glu M225E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Leu228Glu L228E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Phe229Ala F229A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.Phe119Glu F119E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9P289-1:p.[Asp242Ala;Lys276Ala] D242A/K276A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false Deletion of region 222-233 decreased the interaction rate/strength.