IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ cheng-2013-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Cheng X., Veverka V., Radhakrishnan A., Waters LC., Muskett FW., Morgan SH., Huo J., Yu C., Evans EJ., Leslie AJ., Griffiths M., Stubberfield C., Griffin R., Henry AJ., Jansson A., Ladbury JE., Ikemizu S., Carr MD., Davis SJ. mdc12@le.ac.uk,simon.davis@imm.ox.ac.uk The Journal of biological chemistry 2013 Only protein-protein interactions imex curation imex curation cheng-2013-3 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Cheng X., Veverka V., Radhakrishnan A., Waters LC., Muskett FW., Morgan SH., Huo J., Yu C., Evans EJ., Leslie AJ., Griffiths M., Stubberfield C., Griffin R., Henry AJ., Jansson A., Ladbury JE., Ikemizu S., Carr MD., Davis SJ. mdc12@le.ac.uk,simon.davis@imm.ox.ac.uk The Journal of biological chemistry 2013 Only protein-protein interactions imex curation imex curation cheng-2013-4 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Cheng X., Veverka V., Radhakrishnan A., Waters LC., Muskett FW., Morgan SH., Huo J., Yu C., Evans EJ., Leslie AJ., Griffiths M., Stubberfield C., Griffin R., Henry AJ., Jansson A., Ladbury JE., Ikemizu S., Carr MD., Davis SJ. mdc12@le.ac.uk,simon.davis@imm.ox.ac.uk The Journal of biological chemistry 2013 Only protein-protein interactions imex curation imex curation cheng-2013-1 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Cheng X., Veverka V., Radhakrishnan A., Waters LC., Muskett FW., Morgan SH., Huo J., Yu C., Evans EJ., Leslie AJ., Griffiths M., Stubberfield C., Griffin R., Henry AJ., Jansson A., Ladbury JE., Ikemizu S., Carr MD., Davis SJ. PD-L1 and PD-L2: ECD sequence numbering as given in Table S1;these refers to UniProt sequence numbering starting from residue 1 - as determined by residue mapping from fig 4. hPD-1 ECD construct (stated to be residues 14-130) refers to Uniprot Q15116 aas 34-150 as detemined by mutation mapping (C73S which maps to C93S -as confirmed by PDBe entry 2M2D). mdc12@le.ac.uk,simon.davis@imm.ox.ac.uk The Journal of biological chemistry 2013 Only protein-protein interactions imex curation imex curation pd1l1_human Programmed cell death 1 ligand 1 CD274 B7H1 PDCD1L1 PDCD1LG1 PDL1 B7 homolog 1 protein protein human Homo sapiens Human MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET pdcd1_human Programmed cell death protein 1 PDCD1 PD1 protein protein human Homo sapiens Human MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL pd1l2_human Programmed cell death 1 ligand 2 Butyrophilin B7-DC PDCD1LG2 B7DC CD273 PDCD1L2 PDL2 protein protein human Homo sapiens Human MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPTWLLHIFIPFCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI cd80_human T-lymphocyte activation antigen CD80 CD80 CD28LG CD28LG1 LAB7 Activation B7-1 antigen CTLA-4 counter-receptor B7.1 BB1 protein protein human Homo sapiens Human MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV pdcd1_mouse Programmed cell death protein 1 Pdcd1 Pd1 protein protein mouse Mus musculus Mouse MWVRQVPWSFTWAVLQLSWQSGWLLEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQGMVIGIMSALVGIPVLLLLAWALAVFCSTSMSEARGAGSKDDTLKEEPSAAPVPSVAYEELDFQGREKTPELPTACVHTEYATIVFTEGLGASAMGRRGSADGLQGPRPPRHEDGHCSWPL pd1l1_mouse Programmed cell death 1 ligand 1 Cd274 B7h1 Pdcd1l1 Pdcd1lg1 Pdl1 B7 homolog 1 protein protein mouse Mus musculus Mouse MRIFAGIIFTACCHLLRAFTITAPKDLYVVEYGSNVTMECRFPVERELDLLALVVYWEKEDEQVIQFVAGEEDLKPQHSNFRGRASLPKDQLLKGNAALQITDVKLQDAGVYCCIISYGGADYKRITLKVNAPYRKINQRISVDPATSEHELICQAEGYPEAEVIWTNSDHQPVSGKRSVTTSRTEGMLLNVTSSLRVNATANDVFYCTFWRSQPGQNHTAELIIPELPATHPPQNRTHWVLLGSILLFLIVVSTVLLFLRKQVRMLDVEKCGVEDTSSKNRNDTQFEET pdcd2_mouse Programmed cell death protein 2 Zinc finger protein Rp-8 Pdcd2 Rp8 protein protein mouse Mus musculus Mouse MAAAAPGPVELGFAEEAPAWRLRSEQFPSKVGGRPAWLGLAELPGPGALACARCGRPLAFLLQVYAPLPGRDDAFHRSLFLFCCREPLCCAGLRVFRNQLPRNNAFYSYEPPSETEALGTECVCLQLKSGAHLCRVCGCLAPMTCSRCKQAHYCSKEHQTLDWRLGHKQACTQSDKIDHMVPDHNFLFPEFEIVTETEDEILPEVVEMEDYSEVTGSMGGIPEEELDSMAKHESKEDHIFQKFKSKIALEPEQILRYGRGIKPIWISGENIPQEKDIPDCPCGAKRIFEFQVMPQLLNHLKADRLGRSIDWGVLAVFTCAESCSLGSGYTEEFVWKQDVTDTP cd80_mouse T-lymphocyte activation antigen CD80 Cd80 B7 Activation B7-1 antigen protein protein mouse Mus musculus Mouse MACNCQLMQDTPLLKFPCPRLILLFVLLIRLSQVSSDVDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKNTLVLFGAGFGAVITVVVIVVIIKCFCKHRSCFRRNEASRETNNSLTFGPEEALAEQTVFL cd274-pdcd1-7 3316757 N/A 3316761 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role prey prey purified purified Q15116:p.Cys93Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 3316757 Figure 5 A/B, Fig 7, table 2 cd274-pdcd1-8 3316757 N/A 3316763 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role prey prey purified purified Q15116:p.Cys93Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 3316757 Figure 5 C/D, Fig 7, table 2i cd274-pdcd1-9 3316757 N/A 3316761 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 1.0 N/A 3316764 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 direct interaction direct interaction false false false 3316757 Figure 5 E/F, 7, table 2 cd274-pdcd1-10 3316757 N/A 3316761 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316757 Figure 6 A/B, Fig 7, table 2 It is not stated which hPD-1 Fc construct was used nor which expression system. pdcd1-cd274-1 3316757 N/A 3316763 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316757 Figure 6 C/D, Fig 7, table 2 It is not stated which hPD-1 Fc construct was used nor which expression system. cd274-cd80-5 3316757 N/A 3316761 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316764 unspecified role unspecified role bait bait purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 1.0 direct interaction direct interaction false false false 3316757 Table 2 cd80-cd274-2 3316757 N/A 3316765 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316766 unspecified role unspecified role bait bait purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 1.0 direct interaction direct interaction false false false 3316757 Table 2, fig 8 cd274-pdcd1-11 3316757 N/A 3316765 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316767 unspecified role unspecified role bait bait purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 1.0 direct interaction direct interaction false false false 3316757 Table 2, fig 8 pdcd2-pdcd1-1 3316757 N/A 3316768 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. Stoichiometry: 1.0 N/A 3316766 unspecified role unspecified role bait bait purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 1.0 direct interaction direct interaction false false false 3316757 Table 2, fig 8 cd274-pdcd1-12 3316758 N/A 3316761 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316758 Figure 9 B, table 3i-1 It is not stated which hPD-1 Fc construct was used nor which expression system. Kd values ranged from 1.6 uM at pH 6.0 to 3.04 uM at pH 8.0. A rise in temperature lowered the Kd from 3.38 uM at 10degC to ~1.8 uM at 15-25 degC. cd274-pdcd1-14 3316758 N/A 3316761 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316758 Figure 9 B, table 3i-2 It is not stated which hPD-1 Fc construct was used nor which expression system. Kd values ranged from 1.6 uM at pH 6.0 to 3.04 uM at pH 8.0. A rise in temperature lowered the Kd from 3.38 uM at 10degC to ~1.8 uM at 15-25 degC. cd274-pdcd1-15 3316758 N/A 3316761 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316758 Figure 9 B, table 3i-3 It is not stated which hPD-1 Fc construct was used nor which expression system. Kd values ranged from 1.6 uM at pH 6.0 to 3.04 uM at pH 8.0. A rise in temperature lowered the Kd from 3.38 uM at 10degC to ~1.8 uM at 15-25 degC. cd274-pdcd1-16 3316758 N/A 3316761 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316758 Figure 9 B, table 3i-4 It is not stated which hPD-1 Fc construct was used nor which expression system. Kd values ranged from 1.6 uM at pH 6.0 to 3.04 uM at pH 8.0. A rise in temperature lowered the Kd from 3.38 uM at 10degC to ~1.8 uM at 15-25 degC. cd274-pdcd1-17 3316758 N/A 3316761 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316758 Figure 9 B, table 3i-5 It is not stated which hPD-1 Fc construct was used nor which expression system. Kd values ranged from 1.6 uM at pH 6.0 to 3.04 uM at pH 8.0. A rise in temperature lowered the Kd from 3.38 uM at 10degC to ~1.8 uM at 15-25 degC. cd274-pdcd1-18 3316758 N/A 3316761 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316758 Figure 9 B, table 3i-6 It is not stated which hPD-1 Fc construct was used nor which expression system. Kd values ranged from 1.6 uM at pH 6.0 to 3.04 uM at pH 8.0. A rise in temperature lowered the Kd from 3.38 uM at 10degC to ~1.8 uM at 15-25 degC. cd274-pdcd1-19 3316758 N/A 3316761 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316758 Figure 9 B, table 3i-7 It is not stated which hPD-1 Fc construct was used nor which expression system. Kd values ranged from 1.6 uM at pH 6.0 to 3.04 uM at pH 8.0. A rise in temperature lowered the Kd from 3.38 uM at 10degC to ~1.8 uM at 15-25 degC. cd274-pdcd1-20 3316758 N/A 3316761 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316758 Figure 9 B, table 3i-8 It is not stated which hPD-1 Fc construct was used nor which expression system. Kd values ranged from 1.6 uM at pH 6.0 to 3.04 uM at pH 8.0. A rise in temperature lowered the Kd from 3.38 uM at 10degC to ~1.8 uM at 15-25 degC. cd274-pdcd1-21 3316758 N/A 3316761 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316758 Figure 9 B, table 3i-9 It is not stated which hPD-1 Fc construct was used nor which expression system. Kd values ranged from 1.6 uM at pH 6.0 to 3.04 uM at pH 8.0. A rise in temperature lowered the Kd from 3.38 uM at 10degC to ~1.8 uM at 15-25 degC. pdcd1-pdcd1lg2-5 3316759 N/A 3316763 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316759 Figure 9 A/B, table 3-1 It is not stated which hPD-1 Fc construct was used nor which expression system. pdcd1-pdcd1lg2-6 3316759 N/A 3316763 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316759 Figure 9 A/B, table 3-2 It is not stated which hPD-1 Fc construct was used nor which expression system. pdcd1-pdcd1lg2-7 3316759 N/A 3316763 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316759 Figure 9 A/B, table 3-3 It is not stated which hPD-1 Fc construct was used nor which expression system. pdcd1-pdcd1lg2-8 3316759 N/A 3316763 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316759 Figure 9 A/B, table 3-4 It is not stated which hPD-1 Fc construct was used nor which expression system. pdcd1-pdcd1lg2-9 3316759 N/A 3316763 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316759 Figure 9 A/B, table 3-5 It is not stated which hPD-1 Fc construct was used nor which expression system. pdcd1-pdcd1lg2-10 3316759 N/A 3316763 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316759 Figure 9 A/B, table 3-6 It is not stated which hPD-1 Fc construct was used nor which expression system. pdcd1-pdcd1lg2-11 3316759 N/A 3316763 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316759 Figure 9 A/B, table 3-7 It is not stated which hPD-1 Fc construct was used nor which expression system. pdcd1-pdcd1lg2-12 3316759 N/A 3316763 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316759 Figure 9 A/B, table 3-8 It is not stated which hPD-1 Fc construct was used nor which expression system. pdcd1-pdcd1lg2-13 3316759 N/A 3316763 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 Stoichiometry: 1.0 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false 3316759 Figure 9 A/B, table 3-9 It is not stated which hPD-1 Fc construct was used nor which expression system. cd274-pdcd1-6 3316760 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q15116:p.Cys93Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false region 2h label 2h label deuterium D2 2H2 2H2 deuterium D2 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3316761 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction false false false Figure 2A pdcd1-pdcd1lg2-2 3316760 N/A 3316762 unspecified role unspecified role neutral component neutral component purified purified region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q15116:p.Cys93Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false region 2h label 2h label deuterium D2 2H2 2H2 deuterium D2 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3316763 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction false false false Figure 2B