IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ schusdziarra-2013-3 in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Schusdziarra C., Blamowska M., Azem A., Hell K. hell@med.uni-muenchen.de Human molecular genetics 2013 imex curation Only protein-protein interactions schusdziarra-2013-1 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Schusdziarra C., Blamowska M., Azem A., Hell K. Detergent lysed Mitochondria hell@med.uni-muenchen.de Human molecular genetics 2013 imex curation Only protein-protein interactions schusdziarra-2013-2 ecoli Escherichia coli (strain K12) pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schusdziarra C., Blamowska M., Azem A., Hell K. hell@med.uni-muenchen.de Human molecular genetics 2013 imex curation Only protein-protein interactions grp75_human Stress-70 protein, mitochondrial HSPA9 GRP75 HSPA9B 75 kDa glucose-regulated protein Heat shock 70 kDa protein 9 Peptide-binding protein 74 Mortalin mt-HSP70 protein protein human Homo sapiens Human MISASRAAAARLVGAAASRGPTAARHQDSWNGLSHEAFRLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ grpe1_human GrpE protein homolog 1, mitochondrial Mt-GrpE#1 HMGE GRPEL1 GREPEL1 protein protein human Homo sapiens Human MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tim14_human Mitochondrial import inner membrane translocase subunit TIM14 DNAJC19 TIM14 TIMM14 DnaJ homolog subfamily C member 19 protein protein human Homo sapiens Human MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK djc15_human DnaJ homolog subfamily C member 15 DNAJC15 Cell growth-inhibiting gene 22 protein DNAJD1 Methylation-controlled J protein GIG22 HSD18 protein protein human Homo sapiens Human MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH tim16_human Mitochondrial import inner membrane translocase subunit TIM16 Mitochondria-associated granulocyte macrophage CSF-signaling molecule PAM16 CGI-136 MAGMAS TIM16 TIMM16 Presequence translocated-associated motor subunit PAM16 protein protein human Homo sapiens Human MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT tim23_human Mitochondrial import inner membrane translocase subunit Tim23 TIMM23 TIM23 protein protein human Homo sapiens Human MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL tim50_human Mitochondrial import inner membrane translocase subunit TIM50 TIMM50 TIM50 PRO1512 protein protein human Homo sapiens Human MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP ti17b_human Mitochondrial import inner membrane translocase subunit Tim17-B TIMM17B TIM17B JM3 protein protein human Homo sapiens Human MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH ti17a_human Mitochondrial import inner membrane translocase subunit Tim17-A Inner membrane preprotein translocase Tim17a TIMM17A MIMT17 TIM17 TIM17A TIMM17 protein protein human Homo sapiens Human MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ 2354r23-2 2959431 N/A 2959434 enzyme enzyme neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mature_protein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A MGE1 2959435 ancillary ancillary neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 2959436 enzyme target enzyme target substrate substrate neutral component neutral component atpase reaction atpase reaction false false false 5-1 Enzyme activity = 0.033 mol ATP/ mol mortalin/ minute. atp-grpel1-1 2959431 N/A 2959437 stimulator stimulator neutral component neutral component soluble_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 2959434 enzyme enzyme neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mature_protein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A MGE1 2959435 ancillary ancillary neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 2959436 enzyme target enzyme target substrate substrate neutral component neutral component atpase reaction atpase reaction false false false 5-2 Enzyme activity is ~ 0.09 mol ATP/ mol mortalin/ minute. atp-dnajc19-1 2959431 N/A 2959438 stimulator stimulator neutral component neutral component soluble_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 2959434 enzyme enzyme neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mature_protein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A MGE1 2959435 ancillary ancillary neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 2959436 enzyme target enzyme target substrate substrate neutral component neutral component atpase reaction atpase reaction false false false 5-3 Enzyme activity is ~ 0.1 mol ATP/ mol mortalin/ minute. atp-dnajc15-1 2959431 N/A 2959439 inhibitor inhibitor neutral component neutral component soluble_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 2959438 stimulator stimulator neutral component neutral component soluble_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 2959434 enzyme enzyme neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mature_protein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A MGE1 2959435 ancillary ancillary neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 2959436 enzyme target enzyme target substrate substrate neutral component neutral component atpase reaction atpase reaction false false false 5-4 Enzyme activity is ~ 0.04 mol ATP/ mol mortalin/ minute. The basal ATPase activity of mortalin was not decreased in the presence of MAGMAS(s) when added alone, in the absence of MCJ. atp-dnajc15-2 2959431 N/A 2959439 inhibitor inhibitor neutral component neutral component soluble_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 2959438 stimulator stimulator neutral component neutral component soluble_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2959434 enzyme enzyme neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mature_protein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A MGE1 2959435 ancillary ancillary neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 2959436 enzyme target enzyme target substrate substrate neutral component neutral component 2959489 2959486 atpase reaction atpase reaction false false false 5-5 Enzyme activity is ~ 0.05 mol ATP/ mol mortalin/ minute. The basal ATPase activity of mortalin was not decreased in the presence of MAGMAS(s) when added alone, in the absence of MCJ. pre-incubation of his-tagged MAGMAS(s) with MCJ(s) 25qawtrw-1 2959432 N/A 2959439 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep N/A 2959440 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep N/A 2959441 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep N/A 2959438 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep N/A 2959442 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep association association false false false 3A cells were lysed with digitonin timm17b-dnajc15-1 2959432 N/A 2959439 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep N/A 2959443 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep N/A 2959438 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep N/A 2959442 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep association association false false false 3B-1 cells were lysed with digitonin dnajc15-pam16-1 2959432 N/A 2959439 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep N/A 2959438 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep N/A 2959442 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep association association false false false 3B-2 cells were lysed with digitonin dnajc15-pam16-2 2959432 N/A 2959439 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep N/A 2959438 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physical association physical association false false false 3C cells were lysed with Triton-X-100 dnajc15-pam16-3 2959433 N/A 2959438 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep soluble_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2959439 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false soluble_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 2959519 2959516 physical association physical association false false false 3D