DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hoefig-2013-1 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hoefig KP., Rath N., Heinz GA., Wolf C., Dameris J., Schepers A., Kremmer E., Ansel KM., Heissmeyer V. DIP original experiment: DIP-251959X Nature structural & molecular biology 2013 IMEx Eri1 degrades the stem-loop of oligouridylated histone mRNAs to induce replication-dependent decay. Hoefig KP., Rath N., Heinz GA., Wolf C., Dameris J., Schepers A., Kremmer E., Ansel KM., Heissmeyer V. Only protein-protein interactions imex curation hoefig-2013-2 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hoefig KP., Rath N., Heinz GA., Wolf C., Dameris J., Schepers A., Kremmer E., Ansel KM., Heissmeyer V. DIP original experiment: DIP-251962X Nature structural & molecular biology 2013 IMEx Eri1 degrades the stem-loop of oligouridylated histone mRNAs to induce replication-dependent decay. Hoefig KP., Rath N., Heinz GA., Wolf C., Dameris J., Schepers A., Kremmer E., Ansel KM., Heissmeyer V. Only protein-protein interactions imex curation hoefig-2013-3 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hoefig KP., Rath N., Heinz GA., Wolf C., Dameris J., Schepers A., Kremmer E., Ansel KM., Heissmeyer V. DIP original experiment: DIP-251960X Nature structural & molecular biology 2013 IMEx Eri1 degrades the stem-loop of oligouridylated histone mRNAs to induce replication-dependent decay. Hoefig KP., Rath N., Heinz GA., Wolf C., Dameris J., Schepers A., Kremmer E., Ansel KM., Heissmeyer V. Only protein-protein interactions imex curation hoefig-2013-4 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hoefig KP., Rath N., Heinz GA., Wolf C., Dameris J., Schepers A., Kremmer E., Ansel KM., Heissmeyer V. DIP original experiment: DIP-251963X Nature structural & molecular biology 2013 IMEx Eri1 degrades the stem-loop of oligouridylated histone mRNAs to induce replication-dependent decay. Hoefig KP., Rath N., Heinz GA., Wolf C., Dameris J., Schepers A., Kremmer E., Ansel KM., Heissmeyer V. Only protein-protein interactions imex curation hoefig-2013-5 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hoefig KP., Rath N., Heinz GA., Wolf C., Dameris J., Schepers A., Kremmer E., Ansel KM., Heissmeyer V. DIP original experiment: DIP-251961X Nature structural & molecular biology 2013 IMEx Eri1 degrades the stem-loop of oligouridylated histone mRNAs to induce replication-dependent decay. Hoefig KP., Rath N., Heinz GA., Wolf C., Dameris J., Schepers A., Kremmer E., Ansel KM., Heissmeyer V. Only protein-protein interactions imex curation eri1_mouse 3'-5' exoribonuclease 1 Eri1 3'exo Thex1 3'-5' exonuclease ERI1 Eri-1 homolog Histone mRNA 3'-exonuclease 1 protein protein mouse Mus musculus Mouse MEDERGRERGGDAAQQKTPRPECEESRPLSVEKKQRCRLDGKETDGSKFISSNGSDFSDPVYKEIAMTNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESSAGDSYYDYICIIDFEATCEEGNPAEFLHEIIEFPVVLLNTHTLEIEDTFQQYVRPEVNAQLSEFCIGLTGITQDQVDRADAFPQVLKKVIEWMKSKELGTKYKYCILTDGSWDMSKFLSIQCRLSRLKHPAFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHSGLDDSKNIARIAVRMLQDGCELRINEKILGGQLMSVSSSLPVEGAPAPQMPHSRK lsm1_mouse U6 snRNA-associated Sm-like protein LSm1 Lsm1 protein protein mouse Mus musculus Mouse MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVQQQTRLEAEKLKVQTLKDRGLSIPRADTLDEY rent1_mouse Regulator of nonsense transcripts 1 Upf1 Rent1 ATP-dependent helicase RENT1 Nonsense mRNA reducing factor 1 Up-frameshift suppressor 1 homolog protein protein mouse Mus musculus Mouse MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGAGGPGGAGAGGAAGQLDAQVGPEGILQNGAVDDSVAKTSQLLAELNFEEDEEDTYYTKDLPVHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETVLECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAFFTLPKTDSGNEDLVIIWLRDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVVIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLSYYKEQKALVEGPLNNLRESLMQFSKPRKLVNTVNPGARFMTTAMYDAREAIIPGSVYDRSSQGRPSNMYFQTHDQISMISAGPSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRGTPKTKTGRGGRQKNRFGLPGPSQTTLPNSQASQDVASQPFSQGALTQGYVSMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLSQY lsm4_mouse U6 snRNA-associated Sm-like protein LSm4 Lsm4 protein protein mouse Mus musculus Mouse MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVREEAAKGRGRGGPQQKQQKGRGMGGAGRGVFGGRGRGGIPGAGRGQPEKKPGRQAGKQ lsm1-eri1-1 3248111 N/A 3248116 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3248117 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false eri1-upf1-1 3248112 N/A 3248118 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3248116 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false eri1-lsm1-1 3248113 N/A 3248116 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse N/A 3248117 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false eri1-lsm4-1 3248114 N/A 3248119 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3248116 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false eri1-lsm1-2 3248115 N/A 3248118 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3248116 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse N/A 3248117 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false