DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ otomo-2013-1 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Otomo C., Metlagel Z., Takaesu G., Otomo T. DIP original experiment: DIP-251948X Nature structural & molecular biology 2013 IMEx Structure of the human ATG12~ATG5 conjugate required for LC3 lipidation in autophagy. Otomo C., Metlagel Z., Takaesu G., Otomo T. Only protein-protein interactions imex curation otomo-2013-2 in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Otomo C., Metlagel Z., Takaesu G., Otomo T. DIP original experiment: DIP-251950X Nature structural & molecular biology 2013 IMEx Structure of the human ATG12~ATG5 conjugate required for LC3 lipidation in autophagy. Otomo C., Metlagel Z., Takaesu G., Otomo T. Only protein-protein interactions imex curation otomo-2013-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Otomo C., Metlagel Z., Takaesu G., Otomo T. DIP original experiment: DIP-251951X Nature structural & molecular biology 2013 IMEx Structure of the human ATG12~ATG5 conjugate required for LC3 lipidation in autophagy. Otomo C., Metlagel Z., Takaesu G., Otomo T. Only protein-protein interactions imex curation otomo-2013-4 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Otomo C., Metlagel Z., Takaesu G., Otomo T. DIP original experiment: DIP-251949X Nature structural & molecular biology 2013 IMEx Structure of the human ATG12~ATG5 conjugate required for LC3 lipidation in autophagy. Otomo C., Metlagel Z., Takaesu G., Otomo T. Only protein-protein interactions imex curation atg3_mouse Ubiquitin-like-conjugating enzyme ATG3 Atg3 Apg3l Autophagy-related protein 3 protein protein mouse Mus musculus Mouse MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTDKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLESKDSIKLQDCSALCDEEDEEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKADAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM atg12_human Ubiquitin-like protein ATG12 Autophagy-related protein 12 ATG12 APG12 APG12L protein protein human Homo sapiens Human MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG a16l1_human Autophagy-related protein 16-1 APG16-like 1 UNQ9393/PRO34307 ATG16L1 APG16L protein protein human Homo sapiens Human MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY atg5_human Autophagy protein 5 APG5-like Apoptosis-specific protein ATG5 APG5L ASP protein protein human Homo sapiens Human MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD atg3_human Ubiquitin-like-conjugating enzyme ATG3 Autophagy-related protein 3 Protein PC3-96 ATG3 APG3 APG3L protein protein human Homo sapiens Human MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM atg12-atg3-7 3248044 N/A 3248048 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3248049 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false O94817:p.Lys54Asp K54D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false O94817:p.Lys72Asp K72D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false O94817:p.Trp73Ala W73A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse physical association physical association false false false atg16l1-atg5-2 3248045 N/A 3248050 unspecified role unspecified role unspecified role unspecified role Region 11-43 Region 11-43 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3248051 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false atg16l1-atg5-6 3248046 N/A 3248050 unspecified role unspecified role unspecified role unspecified role Region 11-43 Region 11-43 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3248051 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false atg12-atg3-8 3248047 N/A 3248052 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3248049 unspecified role unspecified role unspecified role unspecified role Region 52-140 Region 52-140 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false