DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ qin-2013-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Qin J., Wu SP., Creighton CJ., Dai F., Xie X., Cheng CM., Frolov A., Ayala G., Lin X., Feng XH., Ittmann MM., Tsai SJ., Tsai MJ., Tsai SY. DIP original experiment: DIP-255901X Nature 2013 IMEx COUP-TFII inhibits TGF-β-induced growth barrier to promote prostate tumorigenesis. Qin J., Wu SP., Creighton CJ., Dai F., Xie X., Cheng CM., Frolov A., Ayala G., Lin X., Feng XH., Ittmann MM., Tsai SJ., Tsai MJ., Tsai SY. Only protein-protein interactions imex curation qin-2013-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Qin J., Wu SP., Creighton CJ., Dai F., Xie X., Cheng CM., Frolov A., Ayala G., Lin X., Feng XH., Ittmann MM., Tsai SJ., Tsai MJ., Tsai SY. DIP original experiment: DIP-255902X Nature 2013 IMEx COUP-TFII inhibits TGF-β-induced growth barrier to promote prostate tumorigenesis. Qin J., Wu SP., Creighton CJ., Dai F., Xie X., Cheng CM., Frolov A., Ayala G., Lin X., Feng XH., Ittmann MM., Tsai SJ., Tsai MJ., Tsai SY. Only protein-protein interactions imex curation qin-2013-3 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Qin J., Wu SP., Creighton CJ., Dai F., Xie X., Cheng CM., Frolov A., Ayala G., Lin X., Feng XH., Ittmann MM., Tsai SJ., Tsai MJ., Tsai SY. DIP original experiment: DIP-255904X Nature 2013 IMEx COUP-TFII inhibits TGF-β-induced growth barrier to promote prostate tumorigenesis. Qin J., Wu SP., Creighton CJ., Dai F., Xie X., Cheng CM., Frolov A., Ayala G., Lin X., Feng XH., Ittmann MM., Tsai SJ., Tsai MJ., Tsai SY. Only protein-protein interactions imex curation qin-2013-4 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Qin J., Wu SP., Creighton CJ., Dai F., Xie X., Cheng CM., Frolov A., Ayala G., Lin X., Feng XH., Ittmann MM., Tsai SJ., Tsai MJ., Tsai SY. DIP original experiment: DIP-255903X Nature 2013 IMEx COUP-TFII inhibits TGF-β-induced growth barrier to promote prostate tumorigenesis. Qin J., Wu SP., Creighton CJ., Dai F., Xie X., Cheng CM., Frolov A., Ayala G., Lin X., Feng XH., Ittmann MM., Tsai SJ., Tsai MJ., Tsai SY. Only protein-protein interactions imex curation smad4_human Mothers against decapentaplegic homolog 4 SMAD4 DPC4 MADH4 SMAD family member 4 Deletion target in pancreatic carcinoma 4 protein protein human Homo sapiens Human MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD cot2_human COUP transcription factor 2 NR2F2 ARP1 TFCOUP2 COUP transcription factor II Nuclear receptor subfamily 2 group F member 2 Apolipoprotein A-I regulatory protein 1 protein protein human Homo sapiens Human MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ nr2f2-smad4-1 3247999 N/A 3248003 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3248004 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false smad4-nr2f2-1 3248000 N/A 3248004 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3248003 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false smad4-nr2f2-2 3248001 N/A 3248004 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3248003 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false smad4-nr2f2-3 3248002 N/A 3248004 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 79-414 Region 79-414 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 79-120 Region 79-120 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3248003 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false