DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ withers-2012-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Withers J., Yao J., Mecey C., Howe GA., Melotto M., He SY. DIP original experiment: DIP-251835X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Transcription factor-dependent nuclear localization of a transcriptional repressor in jasmonate hormone signaling. Withers J., Yao J., Mecey C., Howe GA., Melotto M., He SY. Only protein-protein interactions imex curation withers-2012-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Withers J., Yao J., Mecey C., Howe GA., Melotto M., He SY. DIP original experiment: DIP-251837X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Transcription factor-dependent nuclear localization of a transcriptional repressor in jasmonate hormone signaling. Withers J., Yao J., Mecey C., Howe GA., Melotto M., He SY. Only protein-protein interactions imex curation withers-2012-3 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Withers J., Yao J., Mecey C., Howe GA., Melotto M., He SY. DIP original experiment: DIP-251839X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Transcription factor-dependent nuclear localization of a transcriptional repressor in jasmonate hormone signaling. Withers J., Yao J., Mecey C., Howe GA., Melotto M., He SY. Only protein-protein interactions imex curation withers-2012-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Withers J., Yao J., Mecey C., Howe GA., Melotto M., He SY. DIP original experiment: DIP-251836X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Transcription factor-dependent nuclear localization of a transcriptional repressor in jasmonate hormone signaling. Withers J., Yao J., Mecey C., Howe GA., Melotto M., He SY. Only protein-protein interactions imex curation withers-2012-5 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Withers J., Yao J., Mecey C., Howe GA., Melotto M., He SY. DIP original experiment: DIP-251838X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Transcription factor-dependent nuclear localization of a transcriptional repressor in jasmonate hormone signaling. Withers J., Yao J., Mecey C., Howe GA., Melotto M., He SY. Only protein-protein interactions imex curation withers-2012-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Withers J., Yao J., Mecey C., Howe GA., Melotto M., He SY. DIP original experiment: DIP-251840X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Transcription factor-dependent nuclear localization of a transcriptional repressor in jasmonate hormone signaling. Withers J., Yao J., Mecey C., Howe GA., Melotto M., He SY. Only protein-protein interactions imex curation myc2_arath Transcription factor MYC2 MYC2 BHLH6 Basic helix-loop-helix protein 6 EN38 JAI1 JIN1 Protein JASMONATE INSENSITIVE 1 R-homologous Arabidopsis protein 1 RAP1 RD22BP1 Transcription factor EN 38 Z-box binding factor 1 protein ZBF1 bHLH transcription factor bHLH006 rd22BP1 F6N18.4 At1g32640 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTDYRLQPTMNLWTTDDNASMMEAFMSSSDISTLWPPASTTTTTATTETTPTPAMEIPAQAGFNQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKANPRRRSSSPPFSTPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACGAGLAGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMHTIACIPSANGVVEVGSTEPIRQSSDLINKVRILFNFDGGAGDLSGLNWNLDPDQGENDPSMWINDPIGTPGSNEPGNGAPSSSSQLFSKSIQFENGSSSTITENPNLDPTPSPVHSQTQNPKFNNTFSRELNFSTSSSTLVKPRSGEILNFGDEGKRSSGNPDPSSYSGQTQFENKRKRSMVLNEDKVLSFGDKTAGESDHSDLEASVVKEVAVEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEEVKLELAGRKASASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG ti10a_arath Protein TIFY 10A TIFY10A JAZ1 At1g19180 T29M8.5 Jasmonate ZIM domain-containing protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSMECSEFVGSRRFTGKKPSFSQTCSRLSQYLKENGSFGDLSLGMACKPDVNGTLGNSRQPTTTMSLFPCEASNMDSMVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVFNDFSAEKAKEVINLASKGTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQTTGNMSWLGLAAEI coi1_arath Coronatine-insensitive protein 1 FBL2 At2g39940 COI1 COI-1 F-box/LRR-repeat protein 2 T28M21.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEDPDIKRCKLSCVATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSETREHVTMALCYTATPDRLSRRFPNLRSLKLKGKPRAAMFNLIPENWGGYVTPWVTEISNNLRQLKSVHFRRMIVSDLDLDRLAKARADDLETLKLDKCSGFTTDGLLSIVTHCRKIKTLLMEESSFSEKDGKWLHELAQHNTSLEVLNFYMTEFAKISPKDLETIARNCRSLVSVKVGDFEILELVGFFKAAANLEEFCGGSLNEDIGMPEKYMNLVFPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETRNVIGDRGLEVLAQYCKQLKRLRIERGADEQGMEDEEGLVSQRGLIALAQGCQELEYMAVYVSDITNESLESIGTYLKNLCDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYLRQGGLTDLGLSYIGQYSPNVRWMLLGYVGESDEGLMEFSRGCPNLQKLEMRGCCFSERAIAAAVTKLPSLRYLWVQGYRASMTGQDLMQMARPYWNIELIPSRRVPEVNQQGEIREMEHPAHILAYYSLAGQRTDCPTTVRVLKEPI tif7_arath Protein TIFY 7 TIFY7 JAZ9 F5A18.12 At1g70700 Jasmonate ZIM domain-containing protein 9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLSDKQYLSNNVKHEVNDDAVEERGLSTKAAREWGKSKVFATSSFMPSSDFQEAKAFPGAYQWGSVSAANVFRRCQFGGAFQNATPLLLGGSVPLPTHPSLVPRVASSGSSPQLTIFYGGTISVFNDISPDKAQAIMLCAGNGLKGETGDSKPVREAERMYGKQIHNTAATSSSSATHTDNFSRCRDTPVAATNAMSMIESFNAAPRNMIPSVPQARKASLARFLEKRKERLMSAMPYKKMLLDLSTGESSGMNYSSTSPT tify10a-myc2-6 3247532 N/A 3247538 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3247539 unspecified role unspecified role bait bait Region 1-126 Region 1-126 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false coi1-tify7-1 3247533 N/A 3247540 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3247541 unspecified role unspecified role prey prey Q8W4J8:p.Arg234Ala R234A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q8W4J8:p.[Lys233Ala;Arg234Ala;Lys235Ala] K233A/R234A/K235A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q8W4J8:p.[Lys233Ala;Arg234Ala] K233A/R234A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q8W4J8:p.[Arg223Ala;Lys224Ala] R223A/K224A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false myc2-tify7-3 3247534 N/A 3247541 unspecified role unspecified role prey prey Region 220-246 Region 220-246 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3247538 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false tify7-myc2-5 3247535 N/A 3247541 unspecified role unspecified role bait bait Region 220-246 Region 220-246 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q8W4J8:p.Arg234Ala R234A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q8W4J8:p.[Lys233Ala;Arg234Ala;Lys235Ala] K233A/R234A/K235A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q8W4J8:p.[Lys233Ala;Arg234Ala] K233A/R234A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3247538 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false myc2-tify10a-3 3247536 N/A 3247538 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3247539 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false tify7-myc2-6 3247537 N/A 3247541 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3247538 unspecified role unspecified role prey prey Region 1-333 Region 1-333 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false