DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ acquaviva-2013-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Acquaviva L., Székvölgyi L., Dichtl B., Dichtl BS., de La Roche Saint André C., Nicolas A., Géli V. DIP original experiment: DIP-264947X Science (New York, N.Y.) 2013 IMEx The COMPASS subunit Spp1 links histone methylation to initiation of meiotic recombination. Acquaviva L., Székvölgyi L., Dichtl B., Dichtl BS., de La Roche Saint André C., Nicolas A., Géli V. Only protein-protein interactions imex curation acquaviva-2013-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Acquaviva L., Székvölgyi L., Dichtl B., Dichtl BS., de La Roche Saint André C., Nicolas A., Géli V. DIP original experiment: DIP-264948X Science (New York, N.Y.) 2013 IMEx The COMPASS subunit Spp1 links histone methylation to initiation of meiotic recombination. Acquaviva L., Székvölgyi L., Dichtl B., Dichtl BS., de La Roche Saint André C., Nicolas A., Géli V. Only protein-protein interactions imex curation acquaviva-2013-3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Acquaviva L., Székvölgyi L., Dichtl B., Dichtl BS., de La Roche Saint André C., Nicolas A., Géli V. DIP original experiment: DIP-264949X Science (New York, N.Y.) 2013 IMEx The COMPASS subunit Spp1 links histone methylation to initiation of meiotic recombination. Acquaviva L., Székvölgyi L., Dichtl B., Dichtl BS., de La Roche Saint André C., Nicolas A., Géli V. Only protein-protein interactions imex curation re107_yeast Recombination protein 107 MER2 J1462 YJR021C REC107 Meiotic recombination protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVARGRTDEISTDVSEANSEHSLMITETSSPFRSIFSHSGKVANAGALEESDKQILEWAGKLELESMELRENSDKLIKVLNENSKTLCKSLNKFNQLLEQDAATNGNVKTLIKDLASQIENQLDKVSTAMLSKGDEKKTKSDSSYRQVLVEEISRYNSKITRHVTNKQHETEKSMRCTQEMLFNVGSQLEDVHKVLLSLSKDMHSLQTRQTALEMAFREKADHAYDRPDVSLNGTTLLHDMDEAHDKQRKKSVPPPRMMVTRSMKRRRSSSPTLSTSQNHNSEDNDDASHRLKRAARTIIPWEELRPDTLESEL 46F426AC0DFDFAD0 spp1_yeast COMPASS component SPP1 SPP1 SAF41 Complex proteins associated with SET1 protein SPP1 Set1C component SPP1 Suppressor of PRP protein 1 CPS40 YPL138C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLPQWCPPHSTLKRNPTTGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYCQAGITGKNKDAIINGEGSLPKTLWKRKCRISDCYKPCLQDSKYCSEEHGREFVNDIWSRLKTDEDRAVVKKMVEQTGHIDKFKKFGQLDFIDNNIVVKTDDEKEIFDQIVVRDMTLKTLEDDLQEVQEISLPLFKKKLELLEVYLGWLDNVYTEMRKLDDDAASHVECGKEDSKGTKRKKKKNSSRSRARKNICGYCSTYERIPCSVEEFVRDFGSNEEATKIHEVCTKWKCNRHLDWVSTNQEQYLQQIDSLESMQERLQHLIQARKKQLNIQYYEEILRRGL F4B8DFE0CB358CA4 spp1-mer2-1 3247490 N/A 3247493 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3247494 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false mer2-spp1-1 3247491 N/A 3247493 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3247494 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false mer2-spp1-2 3247492 N/A 3247493 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3247494 unspecified role unspecified role prey prey Region 224-353 Region 224-353 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false