DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kaiser-2012-2 in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. DIP original experiment: DIP-251408X Nature structural & molecular biology 2012 IMEx Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. Only protein-protein interactions imex curation kaiser-2012-3 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. DIP original experiment: DIP-251412X Nature structural & molecular biology 2012 IMEx Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. Only protein-protein interactions imex curation kaiser-2012-4 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. DIP original experiment: DIP-251406X Nature structural & molecular biology 2012 IMEx Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. Only protein-protein interactions imex curation kaiser-2012-5 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. DIP original experiment: DIP-251411X Nature structural & molecular biology 2012 IMEx Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. Only protein-protein interactions imex curation kaiser-2012-6 in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. DIP original experiment: DIP-251409X Nature structural & molecular biology 2012 IMEx Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. Only protein-protein interactions imex curation kaiser-2012-7 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. DIP original experiment: DIP-251407X Nature structural & molecular biology 2012 IMEx Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. Only protein-protein interactions imex curation kaiser-2012-8 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. DIP original experiment: DIP-251413X Nature structural & molecular biology 2012 IMEx Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. Only protein-protein interactions imex curation kaiser-2012-9 in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. DIP original experiment: DIP-251410X Nature structural & molecular biology 2012 IMEx Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. Only protein-protein interactions imex curation atg8_yeast Autophagy-related protein 8 ATG8 APG8 AUT7 YBL078C YBL0732 CVT5 Autophagy-related ubiquitin-like modifier ATG8 Cytoplasm to vacuole targeting protein 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR 1246CEFF5A038819 atg3_yeast Autophagy-related protein 3 Autophagy-related E2-like conjugation enzyme ATG3 ATG3 AUT1 YNR007C N2040 APG3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIRSTLSSWREYLTPITHKSTFLTTGQITPEEFVQAGDYLCHMFPTWKWNEESSDISYRDFLPKNKQFLIIRKVPCDKRAEQCVEVEGPDVIMKGFAEDGDEDDVLEYIGSETEHVQSTPAGGTKDSSIDDIDELIQDMEIKEEDENDDTEEFNAKGGLAKDMAQERYYDLYIAYSTSYRVPKMYIVGFNSNGSPLSPEQMFEDISADYRTKTATIEKLPFYKNSVLSVSIHPCKHANVMKILLDKVRVVRQRRRKELQEEQELDGVGDWEDLQDDIDDSLRVDQYLIVFLKFITSVTPSIQHDYTMEGW 52CCFB216B18CF0C atg10_yeast Ubiquitin-like-conjugating enzyme ATG10 Autophagy-related protein 10 ATG10 YLL042C APG10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIPYQEWHSQLQSLYDSQIFHNWALCQDVHLNDEKDGLLLRLIPTRQLQKNTERIENKLLNHIELYLTYSKVYNEPLLLLRIWEEKSIDGIPMTKLMLPTDIESLLDVQGKFQLGLDTIINLEGSVWYSFHPCDTSCIVGDQAEFMSTYLRRWVSIFIFSWLGYEDS 9B90684B8D3D26C5 atg7_yeast Ubiquitin-like modifier-activating enzyme ATG7 ATG7 APG7 CVT2 ATG12-activating enzyme E1 ATG7 Cytoplasm to vacuole targeting protein 2 Autophagy-related protein 7 YHR171W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSERVLSYAPAFKSFLDTSFFQELSRLKLDVLKLDSTCQPLTVNLDLHNIPKSADQVPLFLTNRSFEKHNNKRTNEVPLQGSIFNFNVLDEFKNLDKQLFLHQRALECWEDGIKDINKCVSFVIISFADLKKYRFYYWLGVPCFQRPSSTVLHVRPEPSLKGLFSKCQKWFDVNYSKWVCILDADDEIVNYDKCIIRKTKVLAIRDTSTMENVPSALTKNFLSVLQYDVPDLIDFKLLIIRQNEGSFALNATFASIDPQSSSSNPDMKVSGWERNVQGKLAPRVVDLSSLLDPLKIADQSVDLNLKLMKWRILPDLNLDIIKNTKVLLLGAGTLGCYVSRALIAWGVRKITFVDNGTVSYSNPVRQALYNFEDCGKPKAELAAASLKRIFPLMDATGVKLSIPMIGHKLVNEEAQHKDFDRLRALIKEHDIIFLLVDSRESRWLPSLLSNIENKTVINAALGFDSYLVMRHGNRDEQSSKQLGCYFCHDVVAPTDSLTDRTLDQMCTVTRPGVAMMASSLAVELMTSLLQTKYSGSETTVLGDIPHQIRGFLHNFSILKLETPAYEHCPACSPKVIEAFTDLGWEFVKKALEHPLYLEEISGLSVIKQEVERLGNDVFEWEDDESDEIA 561EEC94F0ED57F5 atg3-atg8-3 3247023 N/A 3247031 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3247032 unspecified role unspecified role unspecified role unspecified role P40344:p.[Arg72Ala;Lys73Ala;Tyr168Ala] R72A/K73A/Y168A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli covalent binding covalent binding false false false atg10-atg7-2 3247024 N/A 3247033 unspecified role unspecified role unspecified role unspecified role Q07879:p.[Cys26Ala;Cys137Ala] C26A/C137A mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3247034 unspecified role unspecified role unspecified role unspecified role P38862:p.Leu291_Leu292insGlyGlySerGly GGSG-Ins mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain false Region 290-294 Region 290-294 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P38862:p.Cys507Ala C507A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P38862:p.Val285Asp V285D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P38862:p.Tyr137Ala Y137A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false atg3-atg7-1 3247025 N/A 3247032 unspecified role unspecified role unspecified role unspecified role P40344:p.[Cys41Ala;Cys76Ala;Cys83Ala] C41A/C76A/C83A mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3247034 unspecified role unspecified role unspecified role unspecified role Region 289-630 Region 289-630 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false atg3-atg7-8 3247026 N/A 3247032 unspecified role unspecified role unspecified role unspecified role P40344:p.[Cys41Ala;Cys76Ala;Cys83Ala] C41A/C76A/C83A mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3247034 unspecified role unspecified role unspecified role unspecified role P38862:p.Cys507Ala C507A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P38862:p.Pro283Asp P283D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P38862:p.Val285Ala V285A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P38862:p.Leu291_Leu292insGlyGlySerGly GGSG-Ins mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain false P38862:p.[Lys14Ala;Phe16Ala;Asp18Ala] K14A/F16A/D18A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P38862:p.[Phe16Ala;Phe61Ala] F16A/F61A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false Deletion of region 290-294 decreased the interaction rate/strength. atg7-atg8-1 3247027 N/A 3247034 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3247031 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli covalent binding covalent binding false false false atg10-atg7-3 3247028 N/A 3247033 unspecified role unspecified role unspecified role unspecified role Q07879:p.[Cys26Ala;Cys137Ala] C26A/C137A mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3247034 unspecified role unspecified role unspecified role unspecified role Region 289-630 Region 289-630 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false atg10-atg7-7 3247029 N/A 3247033 unspecified role unspecified role unspecified role unspecified role Q07879:p.[Cys26Ala;Cys137Ala] C26A/C137A mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Region 86-93 Region 86-93 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3247034 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false atg10-atg8-1 3247030 N/A 3247033 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3247031 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli covalent binding covalent binding false false false