DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ larivire-2012-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. DIP original experiment: DIP-252124X Nature 2012 IMEx Structure of the Mediator head module. Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. Only protein-protein interactions imex curation larivire-2012-2 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. DIP original experiment: DIP-252122X Nature 2012 IMEx Structure of the Mediator head module. Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. Only protein-protein interactions imex curation larivire-2012-3 ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. DIP original experiment: DIP-252125X Nature 2012 IMEx Structure of the Mediator head module. Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. Only protein-protein interactions imex curation larivire-2012-4 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. DIP original experiment: DIP-252123X Nature 2012 IMEx Structure of the Mediator head module. Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. Only protein-protein interactions imex curation larivire-2012-5 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. DIP original experiment: DIP-252129X Nature 2012 IMEx Structure of the Mediator head module. Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. Only protein-protein interactions imex curation larivire-2012-6 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. DIP original experiment: DIP-252128X Nature 2012 IMEx Structure of the Mediator head module. Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. Only protein-protein interactions imex curation larivire-2012-7 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. DIP original experiment: DIP-252126X Nature 2012 IMEx Structure of the Mediator head module. Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. Only protein-protein interactions imex curation larivire-2012-8 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. DIP original experiment: DIP-252127X Nature 2012 IMEx Structure of the Mediator head module. Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. Only protein-protein interactions imex curation larivire-2012-9 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. DIP original experiment: DIP-252131X Nature 2012 IMEx Structure of the Mediator head module. Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. Only protein-protein interactions imex curation larivire-2012-10 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. DIP original experiment: DIP-252130X Nature 2012 IMEx Structure of the Mediator head module. Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. Only protein-protein interactions imex curation larivire-2012-11 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. DIP original experiment: DIP-252132X Nature 2012 IMEx Structure of the Mediator head module. Larivière L., Plaschka C., Seizl M., Wenzeck L., Kurth F., Cramer P. Only protein-protein interactions imex curation med22_yeast Mediator of RNA polymerase II transcription subunit 22 SRB6 YBR253W YBR1721 MED22 Mediator complex subunit 22 Suppressor of RNA polymerase B 6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNQALYEKLEQTRTILSVKLAELINMTTIADRNDDDEGSFAQENSELAVATTSVMMVNNQTMQLIKNVQDLLILTRSIKEKWLLNQIPVTEHSKVTRFDEKQIEELLDNCIETFVAEKTT 7703E4FAE101A31F med20_yeast Mediator of RNA polymerase II transcription subunit 20 YHR041C SRB2 HRS2 MED20 Mediator complex subunit 20 Suppressor of RNA polymerase B 2 Hyper-recombination suppressor protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLPADVSKLMYSITFHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQLIKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAKEYKTSSDSLGPDTSNEICDLAYQYVRALEL C30BF309D43AFB2A med18_yeast Mediator of RNA polymerase II transcription subunit 18 YGR104C SRB5 MED18 Mediator complex subunit 18 Suppressor of RNA polymerase B 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVQQLSLFGSIGDDGYDLLISTLTTISGNPPLLYNSLCTVWKPNPSYDVENVNSRNQLVEPNRIKLSKEVPFSYLIDETMMDKPLNFRILKSFTNDKIPLNYAMTRNILHNTVPQVTNFNSTNEDQNNSKHTEDTVNESRNSDDIIDVDMDASPAPSNESCSPWSLQISDIPAAGNNRSVSMQTIAETIILSSAGKNSSVSSLMNGLGYVFEFQYLTIGVKFFMKHGLILELQKIWQIEEAGNSQITSGGFLLKAYINVSRGTDIDRINYTETALMNLKKELQGYIELSVPDRQSMDSRVAHGNILI B1148FC187C2802A med17_yeast Mediator of RNA polymerase II transcription subunit 17 YER022W SRB4 MED17 Mediator complex subunit 17 Suppressor of RNA polymerase B 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTTEDPDSNHLSSETGIKLALDPNLITLALSSNPNSSLHSPTSDEPVPESAGKADTSIRLEGDELENKTKKDNDKNLKFLKNKDSLVSNPHEIYGSMPLEQLIPIILRQRGPGFKFVDLNEKELQNEIKQLGSDSSDGHNSEKKDTDGADENVQIGEDFMEVDYEDKDNPVDSRNETDHKTNENGETDDNIETVMTQEQFVKRRRDMLEHINLAMNESSLALEFVSLLLSSVKESTGMSSMSPFLRKVVKPSSLNSDKIPYVAPTKKEYIELDILNKGWKLQSLNESKDLLRASFNKLSSILQNEHDYWNKIMQSISNKDVIFKIRDRTSGQKLLAIKYGYEDSGSTYKHDRGIANIRNNIESQNLDLIPHSSSVFKGTDFVHSVKKFLRVRIFTKIESEDDYILSGESVMDRDSESEEAETKDIRKQIQLLKKIIFEKELMYQIKKECALLISYGVSIENENKVIIELPNEKFEIELLSLDDDSIVNHEQDLPKINDKRANLMLVMLRLLLVVIFKKTLRSRISSPHGLINLNVDDDILIIRPILGKVRFANYKLLLKKIIKDYVLDIVPGSSITETEVEREQPQENKNIDDENITKLNKEIRAFDKLLNIPRRELKINLPLTEHKSPNLSLMLESPNYCNALIHIKFSAGTEANAVSFDTTFSDFKEVEDFLHFIVAEYIQQKKV D25B2993A1BADFD6 med11_yeast Mediator of RNA polymerase II transcription subunit 11 YMR112C YM9718.11C Mediator complex subunit 11 MED11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK 457D13C6030F33CC med8_yeast Mediator of RNA polymerase II transcription subunit 8 YBR193C YBR1403 MED8 Mediator complex subunit 8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQSTASLVPEGNQGSLQEDVSFDFNGVPGQALDAVRMRLAQLTHSLRRIRDEMSKAELPQWYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVVYPLPKFPTTSHESLVTTLLRKKNIPEVDEWMKYVRETSGVTTALLKDEEIEKLLQQDREITNWARTTFRNEYGKHDFKNEESLSEEHASLLVRDSKPSKPFNVDDVLKFTFTGEKPIITGSTSTSSSN 86B2A064293C6B61 med6_yeast Mediator of RNA polymerase II transcription subunit 6 MTR32 YHR058C Mediator complex subunit 6 MED6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNVTPLDELQWKSPEWIQVFGLRTENVLDYFAESPFFDKTSNNQVIKMQRQFSQLNDPNAAVNMTQNIMTLPDGKNGNLEEEFAYVDPARRQILFKYPMYMQLEEELMKLDGTEYVLSSVREPDFWVIRKQRRTNNSGVGSAKGPEIIPLQDYYIIGANIYQSPTIFKIVQSRLMSTSYHLNSTLESLYDLIEFQPSQGVHYKVPTDTSTTATAATNGNNAGGGSNKSSVRPTGGANMATVPSTTNVNMTVNTMGTGGQTIDNGTGRTGNGNMGITTEMLDKLMVTSIRSTPNYI B84E87DCC2737849 med22_schpo Mediator of RNA polymerase II transcription subunit 22 med22 srb6 SPAC29A4.07 Mediator complex subunit 22 Suppressor of RNA polymerase B 6 homolog protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSSDSFQRQLVQRTNTLNSSIDNATLTILSRFQDILDIAINEGKDKYTVAPEVYQIECHTVSMVRAVEQLLDVSRQIKSYWLTNSLSTSFPTVDYSEPDLEKVKRTLTKLQNHLLEVSLIEPEASETTEAPTVSDT 52EA5A74C06C9FE1 med18_schpo Mediator of RNA polymerase II transcription subunit 18 med18 pmc6 sep11 SPAC5D6.05 Mediator complex subunit 18 Cell separation protein sep11 RNA polymerase II mediator complex protein pmc6 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MQELYLLGVVPSRRFEAVVNSLSKTLDGPKTILEFWVVYRPKDVPPNLPRQPDSWLRLCSNIESHDETDTEWSKNTQWSMYLEGNSEPKREDKCGIRPVNRAKLTNGSVTEFVEKMGYEFSHEYIIQGLEYFFFDTTVRIYQTLIPSQQRSIKPPFHPMNEEQPWILHVYTHVADASNQVAMAKAEANLTKVKTLLSAFCDLKNVRL A3A3B518E3D85A62 med17_schpo Mediator of RNA polymerase II transcription subunit 17 med17 srb4 SPBC31F10.04c Mediator complex subunit 17 Suppressor of RNA polymerase B 4 homolog protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAEEANKDADISSLSLSLDPEIIGGQNNFLENNLQQIFQKIIQERGPFRDLKEEDLQKELQKESIKDESSAKSSETENVLEFATLDSKRNVNDTEVESMDSQAYKKELIEQIMIAQTECSLALDMTSLLLSKFKENSIETISPFLKSTVPPSSLQFSRSQPPESKESDATLAKCWKEKSLTSSCKFLFEAKERLTSVVETEHEYYTELVKVKEASWPLFNSQGSNHLSVQYSCLGGISLGLGLIRMKPESKSFEVQSSLLYSQAALKISILNKDRDEIGSSTWSWPSQNCNSVLLKDIYKLQEILFEMDIWNSLLQEAQSCGNQGVNFTGDEILVPISDDHVVRITLETSSKNTESGFTEDKKSNEDTSTNFVTIKQEKELLKCLCDTLNAIAHILFLKHCRKSDRRSQQPELYMAIDANAPLILRPLIFYYNLNQESLEFQRWLKQRDISFKFMPNYPWEKAKDFLELENSLSINRLSISWRIMVSNFEPAIFIQHTPTLHGTDKSVWRCKDQYSSNQFSSLKNVCQYIEHHINSLSRRSKKTE 5BC16074D9D0A05B med8_schpo Mediator of RNA polymerase II transcription subunit 8 med8 sep15 SPBC21.04 Mediator complex subunit 8 Cell separation protein sep15 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEDISTEKTVESLEAIRHRIAQIVQSLTHFLAILHQSESLSPWPTIHKNFNILLSQIHSLSNNLAAHSHTLQTTSIYPSLEFPVKEQEPLLTTLLRTKALPEVEEWEANTLQEYEASISSQPKKKEANDAYQKDQLWDQARIIFMEERENYSWFDFVTRRQESEGEFVSQRQLEIDRATEEQNANQMLTDILSFMKSGKR A61A9E49B83A86F0 med6_schpo Mediator of RNA polymerase II transcription subunit 6 med6 pmc5 SPAC1002.15c Mediator complex subunit 6 RNA polymerase II mediator complex protein pmc5 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MASGAPPSVDLTSIQWRMPEWVQSMGGLRTENVLEYFSQSPFYSHKSNNEMLKMQSQFNALDLGDLNSQLKRLTGIQFVIIHERPPFLWVIQKQNRLNENEVKPLTVYFVCNENIYMAPNAYTLLATRMLNATYCFQKALTKIEKFPQYNPQEGYTYPKLSNDNLEVDHSNTNEPADENKNQSIENADYSFSPEDFSVVRAFMQSLHSSKEAPDVK 84AE0C11F607F35A med11_schpo Mediator of RNA polymerase II transcription subunit 11 med11 Mediator complex subunit 11 SPAC644.10 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTNSDDDLFSEKSTSSDTQQVQNILELEAKIPDILSSAGKCIEAIQLNNSLEDFRKYSKEFLETVEFISTGLRRQALELEKAEVPVVSLQPKKRYASTPLSNLIFDQSSKLM 8D2077ECDFE8E3DD med20_schpo Mediator of RNA polymerase II transcription subunit 20 med20 Mediator complex subunit 20 SPAC17G8.05 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPVHGVIYYSSPSMATFLSPAQDNLVRTYFAQHLKKWVVQYKLYRNAVTPKTLEFLKQNINPSMLACVDEATMIDAEPELEDIIVRTKLWNFRQSFTIEGSIYEVGSFKVAIANVLQKSVWKGILFHVTYDGTESVDLARPIIQEFFLKCFLQNNKSVTPVYESFFNQPRHSLDSKLLLQLFKQRIDTVSQRT 05AD4D96C2452EA0 scmed11-scmed17-1 3246809 N/A 3246820 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246821 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246822 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246823 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246824 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246825 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246826 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false scmed17-scmed11-1 3246810 N/A 3246820 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3246821 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3246822 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3246823 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3246824 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3246825 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3246826 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false scmed11-scmed17-2 3246811 N/A 3246820 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246821 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246822 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246823 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246824 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246825 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246826 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false scmed11-scmed17-3 3246812 N/A 3246820 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246821 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246822 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246823 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246824 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246825 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246826 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli association association false false false spmed6-spmed11-1 3246813 N/A 3246827 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3246828 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3246829 unspecified role unspecified role prey prey region 77-545 region 77-545 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246830 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3246831 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-180 Region 1-180 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246832 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false spmed11-spmed17-1 3246814 N/A 3246827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246831 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246833 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246832 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false spmed6-spmed11-2 3246815 N/A 3246827 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3246828 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3246829 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3246830 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3246831 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3246833 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3246832 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false spmed11-spmed17-2 3246816 N/A 3246827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246831 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246833 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246832 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli association association false false false spmed11-spmed17-3 3246817 N/A 3246827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246829 unspecified role unspecified role unspecified role unspecified role region 77-545 region 77-545 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246831 unspecified role unspecified role unspecified role unspecified role Region 1-180 Region 1-180 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246832 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false spmed11-spmed17-4 3246818 N/A 3246827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246829 unspecified role unspecified role unspecified role unspecified role region 77-545 region 77-545 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246831 unspecified role unspecified role unspecified role unspecified role Region 1-180 Region 1-180 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246832 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli association association false false false spmed11-spmed17-5 3246819 N/A 3246827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246829 unspecified role unspecified role unspecified role unspecified role region 77-545 region 77-545 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3246831 unspecified role unspecified role unspecified role unspecified role Region 1-180 Region 1-180 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246832 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false