DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ schfer-2012-1 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251391X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251382X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251386X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251400X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-5 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251394X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251387X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-7 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251399X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-8 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251402X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-9 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251383X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-10 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251404X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-11 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251395X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-12 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251392X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-13 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251397X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-14 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251388X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-15 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251384X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-16 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251396X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-17 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251401X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-18 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251389X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-19 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251385X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-20 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251403X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-21 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251405X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-22 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251398X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-23 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251393X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation schfer-2012-24 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251390X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions imex curation anr27_human Ankyrin repeat domain-containing protein 27 ANKRD27 VPS9 domain-containing protein PP12899 protein protein human Homo sapiens Human MALYDEDLLKNPFYLALQKCRPDLCSKVAQIHGIVLVPCKGSLSSSIQSTCQFESYILIPVEEHFQTLNGKDVFIQGNRIKLGAGFACLLSVPILFEETFYNEKEESFSILCIAHPLEKRESSEEPLAPSDPFSLKTIEDVREFLGRHSERFDRNIASFHRTFRECERKSLRHHIDSANALYTKCLQQLLRDSHLKMLAKQEAQMNLMKQAVEIYVHHEIYNLIFKYVGTMEASEDAAFNKITRSLQDLQQKDIGVKPEFSFNIPRAKRELAQLNKCTSPQQKLVCLRKVVQLITQSPSQRVNLETMCADDLLSVLLYLLVKTEIPNWMANLSYIKNFRFSSLAKDELGYCLTSFEAAIEYIRQGSLSAKPPESEGFGDRLFLKQRMSLLSQMTSSPTDCLFKHIASGNQKEVERLLSQEDHDKDTVQKMCHPLCFCDDCEKLVSGRLNDPSVVTPFSRDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPLHLACQKGYQSVTLLLLHYKASAEVQDNNGNTPLHLACTYGHEDCVKALVYYDVESCRLDIGNEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLKCALNSKILSVMEAYHLSFERRQKSSEAPVQSPQRSVDSISQESSTSSFSSMSASSRQEETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPEFCHPLCQCPKCAPAQKRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVASLDDVAETDRKEYVTVKIRKKWNSKLYDLPDEPFTRQFYFVHSAGQFKGKTSREIMARDRSVPNLTEGSLHEPGRQSVTLRQNNLPAQSGSHAAEKGNSDWPERPGLTQTGPGHRRMLRRHTVEDAVVSQGPEAAGPLSTPQEVSASRS vamp7_mouse Vesicle-associated membrane protein 7 Vamp7 Sybl1 Synaptobrevin-like protein 1 protein protein mouse Mus musculus Mouse MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKSLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNIKLTIIIIIVSIVFIYIIVSLLCGGFTWPNCVKK ap3d1_human AP-3 complex subunit delta-1 AP-3 complex subunit delta Delta-adaptin AP3D1 PRO0039 Adaptor-related protein complex 3 subunit delta-1 protein protein human Homo sapiens Human MALKMVKGSIDRMFDKNLQDLVRGIRNHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQMLGYDISWAAFNIIEVMSASKFTFKRIGYLAASQSFHEGTDVIMLTTNQIRKDLSSPSQYDTGVALTGLSCFVTPDLARDLANDIMTLMSHTKPYIRKKAVLIMYKVFLKYPESLRPAFPRLKEKLEDPDPGVQSAAVNVICELARRNPKNYLSLAPLFFKLMTSSTNNWVLIKIIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMSLLYECVNTVIAVLISLSSGMPNHSASIQLCVQKLRILIEDSDQNLKYLGLLAMSKILKTHPKSVQSHKDLILQCLDDKDESIRLRALDLLYGMVSKKNLMEIVKKLMTHVDKAEGTTYRDELLTKIIDICSQSNYQYITNFEWYISILVELTRLEGTRHGHLIAAQMLDVAIRVKAIRKFAVSQMSALLDSAHLLASSTQRNGICEVLYAAAWICGEFSEHLQEPHHTLEAMLRPRVTTLPGHIQAVYVQNVVKLYASILQQKEQAGEAEGAQAVTQLMVDRLPQFVQSADLEVQERASCILQLVKHIQKLQAKDVPVAEEVSALFAGELNPVAPKAQKKVPVPEGLDLDAWINEPLSDSESEDERPRAVFHEEEQRRPKHRPSEADEEELARRREARKQEQANNPFYIKSSPSPQKRYQDTPGVEHIPVVQIDLSVPLKVPGLPMSDQYVKLEEERRHRQKLEKDKRRKKRKEKEKKGKRRHSSLPTESDEDIAPAQQVDIVTEEMPENALPSDEDDKDPNDPYRALDIDLDKPLADSEKLPIQKHRNTETSKSPEKDVPMVEKKSKKPKKKEKKHKEKERDKEKKKEKEKKKSPKPKKKKHRKEKEERTKGKKKSKKQPPGSEEAAGEPVQNGAPEEEQLPPESSYSLLAENSYVKMTCDIRGSLQEDSQVTVAIVLENRSSSILKGMELSVLDSLNARMARPQGSSVHDGVPVPFQLPPGVSNEAQYVFTIQSIVMAQKLKGTLSFIAKNDEGATHEKLDFRLHFSCSSYLITTPCYSDAFAKLLESGDLSMSSIKVDGIRMSFQNLLAKICFHHHFSVVERVDSCASMYSRSIQGHHVCLLVKKGENSVSVDGKCSDSTLLSNLLEEMKATLAKC vti1b_mouse Vesicle transport through interaction with t-SNAREs homolog 1B Vesicle transport v-SNARE protein Vti1-like 1 Vti1-rp1 Vti1b Vti1l1 protein protein mouse Mus musculus Mouse MAASAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDENQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHREVRSTPLTAAPGGRGDLKYGTYTLENEHLNRLQSQRALLLQGTESLNRATQSIERSHRIATETDQIGTEIIEELGEQRDQLERTKSRLVNTNENLSKSRKILRSMSRKVITNKLLLSVIILLELAILVGLVYYKFFRHH agfg1_human Arf-GAP domain and FG repeat-containing protein 1 HIV-1 Rev-binding protein Rev-interacting protein Rev/Rex activation domain-binding protein AGFG1 RAB RIP HRB Nucleoporin-like protein RIP protein protein human Homo sapiens Human MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAASVNANFAHFDNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNIFSAGQGGDQGSGFGTTGKAPVGSVVSVPSQSSASSDKYAALAELDSVFSSAATSSNAYTSTSNASSNVFGTVPVVASAQTQPASSSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNARGATAATFGTASMSMPTGFGTPAPYSLPTSFSGSFQQPAFPAQAAFPQQTAFSQQPNGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPFL stx7_human Syntaxin-7 STX7 protein protein human Homo sapiens Human MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDLGMMIHEQGDVIDSIEANVENAEVHVQQANQQLSRAADYQRKSRKTLCIIILILVIGVAIISLIIWGLNH vamp8_human Vesicle-associated membrane protein 8 Endobrevin VAMP8 protein protein human Homo sapiens Human MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVLICVIVFIIILFIVLFATGAFS stx8_human Syntaxin-8 STX8 protein protein human Homo sapiens Human MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCGMIMVILLLLVAIVVVAVWPTN snp29_human Synaptosomal-associated protein 29 Vesicle-membrane fusion protein SNAP-29 Soluble 29 kDa NSF attachment protein SNAP29 protein protein human Homo sapiens Human MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL rab38_mouse Ras-related protein Rab-38 Rab38 protein protein mouse Mus musculus Mouse MQTPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLTLPNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLLESIEPDIVKPHLTSPKVVSCSGCAKS ankrd27-vamp7-1 3246394 N/A 3246418 unspecified role unspecified role unspecified role unspecified role Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q96NW4:p.[Asp679Ala;Asp681Ala] D679A/D681A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q96NW4:p.[Met684Asp;Tyr687Ser] M684D/Y687S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246419 unspecified role unspecified role unspecified role unspecified role Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ankrd27-vamp7-2 3246395 N/A 3246418 unspecified role unspecified role unspecified role unspecified role Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246419 unspecified role unspecified role unspecified role unspecified role Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false vamp7-ap3d1-2 3246396 N/A 3246420 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3246419 unspecified role unspecified role bait bait Region 1-120 Region 1-120 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false vti1b-vamp7-1 3246397 N/A 3246421 unspecified role unspecified role bait bait Region 117-206 Region 117-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3246419 unspecified role unspecified role prey prey Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false ankrd27-vamp7-3 3246398 N/A 3246418 unspecified role unspecified role unspecified role unspecified role Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246419 unspecified role unspecified role unspecified role unspecified role Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P70280:p.[Asp69Ala;Glu71Phe;Ser73Asp] D69A/E71F/S73D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P70280:p.Arg72Ala R72A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false vamp7-agfg1-1 3246399 N/A 3246422 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3246419 unspecified role unspecified role bait bait Region 1-120 Region 1-120 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false vamp7-stx7-1 3246400 N/A 3246423 unspecified role unspecified role prey prey Region 169-237 Region 169-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246421 unspecified role unspecified role prey prey Region 1-206 Region 1-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246419 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false vti1b-stx7-1 3246401 N/A 3246424 unspecified role unspecified role prey prey Region 1-76 Region 1-76 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246425 unspecified role unspecified role prey prey Region 149-213 Region 149-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246423 unspecified role unspecified role prey prey Region 169-237 Region 169-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246421 unspecified role unspecified role bait bait Region 117-206 Region 117-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3246419 unspecified role unspecified role prey prey Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false ankrd27-vamp7-4 3246402 N/A 3246418 unspecified role unspecified role unspecified role unspecified role Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246419 unspecified role unspecified role unspecified role unspecified role Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false vti1b-stx7-2 3246403 N/A 3246425 unspecified role unspecified role prey prey Region 149-213 Region 149-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246423 unspecified role unspecified role prey prey Region 169-237 Region 169-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246421 unspecified role unspecified role bait bait Region 117-206 Region 117-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3246419 unspecified role unspecified role prey prey Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false vamp7-ankrd27-5 3246404 N/A 3246418 unspecified role unspecified role prey prey Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q96NW4:p.[Met684Asp;Tyr687Ser] M684D/Y687S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246419 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false vamp7-ankrd27-6 3246405 N/A 3246418 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246419 unspecified role unspecified role bait bait Region 1-160 Region 1-160 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false vamp7-ankrd27-7 3246406 N/A 3246425 unspecified role unspecified role prey prey Region 149-213 Region 149-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246423 unspecified role unspecified role prey prey Region 169-237 Region 169-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246421 unspecified role unspecified role prey prey Region 1-206 Region 1-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246418 unspecified role unspecified role prey prey Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246419 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false vamp7-ankrd27-8 3246407 N/A 3246418 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3246419 unspecified role unspecified role bait bait Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false vamp7-ankrd27-9 3246408 N/A 3246418 unspecified role unspecified role prey prey Region 671-731 Region 671-731 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3246419 unspecified role unspecified role bait bait Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false vamp7-ankrd27-10 3246409 N/A 3246421 unspecified role unspecified role prey prey Region 1-206 Region 1-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246418 unspecified role unspecified role prey prey Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246419 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false vti1b-stx7-3 3246410 N/A 3246423 unspecified role unspecified role prey prey Region 169-237 Region 169-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246421 unspecified role unspecified role bait bait Region 117-206 Region 117-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3246419 unspecified role unspecified role prey prey Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false ankrd27-vamp7-5 3246411 N/A 3246418 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3246419 unspecified role unspecified role prey prey Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false vamp7-snap29-1 3246412 N/A 3246426 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3246419 unspecified role unspecified role bait bait Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false vti1b-stx7-4 3246413 N/A 3246424 unspecified role unspecified role prey prey Region 1-76 Region 1-76 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246425 unspecified role unspecified role prey prey Region 149-213 Region 149-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246423 unspecified role unspecified role prey prey Region 169-237 Region 169-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246421 unspecified role unspecified role bait bait Region 117-206 Region 117-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false rab38-ankrd27-3 3246414 N/A 3246427 unspecified role unspecified role bait bait Q8QZZ8:p.Thr23Asn T23N mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3246418 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 451-921 Region 451-921 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246419 unspecified role unspecified role prey prey Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli association association false false false vamp7-stx7-2 3246415 N/A 3246425 unspecified role unspecified role prey prey Region 149-213 Region 149-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246423 unspecified role unspecified role prey prey Region 169-237 Region 169-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246421 unspecified role unspecified role prey prey Region 1-206 Region 1-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246419 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false vamp7-ankrd27-11 3246416 N/A 3246418 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3246419 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false vamp7-ankrd27-12 3246417 N/A 3246418 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3246419 unspecified role unspecified role bait bait Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false