DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yang-2012-11 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang N., Wang W., Wang Y., Wang M., Zhao Q., Rao Z., Zhu B., Xu RM. DIP original experiment: DIP-251821X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Distinct mode of methylated lysine-4 of histone H3 recognition by tandem tudor-like domains of Spindlin1. Yang N., Wang W., Wang Y., Wang M., Zhao Q., Rao Z., Zhu B., Xu RM. Only protein-protein interactions imex curation yang-2012-12 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Yang N., Wang W., Wang Y., Wang M., Zhao Q., Rao Z., Zhu B., Xu RM. DIP original experiment: DIP-251823X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Distinct mode of methylated lysine-4 of histone H3 recognition by tandem tudor-like domains of Spindlin1. Yang N., Wang W., Wang Y., Wang M., Zhao Q., Rao Z., Zhu B., Xu RM. Only protein-protein interactions imex curation yang-2012-13 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yang N., Wang W., Wang Y., Wang M., Zhao Q., Rao Z., Zhu B., Xu RM. DIP original experiment: DIP-251822X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Distinct mode of methylated lysine-4 of histone H3 recognition by tandem tudor-like domains of Spindlin1. Yang N., Wang W., Wang Y., Wang M., Zhao Q., Rao Z., Zhu B., Xu RM. Only protein-protein interactions imex curation yang-2012-14 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Yang N., Wang W., Wang Y., Wang M., Zhao Q., Rao Z., Zhu B., Xu RM. DIP original experiment: DIP-251824X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Distinct mode of methylated lysine-4 of histone H3 recognition by tandem tudor-like domains of Spindlin1. Yang N., Wang W., Wang Y., Wang M., Zhao Q., Rao Z., Zhu B., Xu RM. Only protein-protein interactions imex curation h3k4me3 Histone 3 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ARTKQTARKS spin1_human Spindlin-1 Ovarian cancer-related protein SPIN1 OCR SPIN Spindlin1 protein protein human Homo sapiens Human MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS h3(110)-spin1-1 3246091 N/A 3246095 unspecified role unspecified role unspecified role unspecified role Region 1-8 Region 1-8 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false K4me3 K4me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3246096 unspecified role unspecified role unspecified role unspecified role Region 27-262 Region 27-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false h3(110)-spin1-2 3246092 N/A 3246095 unspecified role unspecified role unspecified role unspecified role Region 1-8 Region 1-8 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false K4me3 K4me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3246096 unspecified role unspecified role unspecified role unspecified role Region 27-262 Region 27-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false h3(110)-spin1-3 3246093 N/A 3246095 unspecified role unspecified role unspecified role unspecified role Region 1-8 Region 1-8 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false K4me3 K4me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3246096 unspecified role unspecified role unspecified role unspecified role Region 27-262 Region 27-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false h3(110)-spin1-4 3246094 N/A 3246095 unspecified role unspecified role unspecified role unspecified role K4me3 K4me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3246096 unspecified role unspecified role unspecified role unspecified role Region 27-262 Region 27-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9Y657:p.Asp184Ala D184A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9Y657:p.Asp189Ala D189A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9Y657:p.Asp184Arg D184R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9Y657:p.Asp189Arg D189R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false