DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ elssser-2012-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251225X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-2 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251247X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251241X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251233X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251226X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251240X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251234X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-8 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251235X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-9 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251243X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-10 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251227X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-11 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251248X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-12 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251242X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-13 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251236X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-14 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251228X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-15 in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251229X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-16 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251249X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-17 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251230X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-18 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251237X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-19 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251244X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-20 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251231X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-21 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251246X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-22 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251238X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-23 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251232X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-24 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251239X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation elssser-2012-25 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. DIP original experiment: DIP-251245X Nature 2012 IMEx DAXX envelops a histone H3.3-H4 dimer for H3.3-specific recognition. Elsässer SJ., Huang H., Lewis PW., Chin JW., Allis CD., Patel DJ. Only protein-protein interactions imex curation h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG h33_human Histone H3.3 H3-3A H3-3B H3.3A H3.3B H3F3 H3F3A H3F3B PP781 protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA q9uer7-1 Death domain-associated protein 6 DAXX BING2 DAP6 Daxx ETS1-associated protein 1 Fas death domain-associated protein protein protein human Homo sapiens Human MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPSGMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCIPSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD h32_human Histone H3.2 H3C13 H3C14 H3C15 H3-clustered histone 13 H3-clustered histone 14 H3-clustered histone 15 H3F2 H3FM HIST2H3A HIST2H3C HIST2H3D Histone H3/m Histone H3/o protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA caf1a_human Chromatin assembly factor 1 subunit A CHAF1A CAF CAF1P150 Chromatin assembly factor I p150 subunit protein protein human Homo sapiens Human MLEELECGAPGARGAATAMDCKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEASLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLTEDSNEQPDSLVDHNKLNSEASPSREAINGQREDTGDQQGLLKAIQNDKLAFPGETLSDIPCKTEEEGVGCGGAGRRGDSQECSPRSCPELTSGPRMCPRKEQDSWSEAGGILFKGKVPMVVLQDILAVRPPQIKSLPATPQGKNMTPESEVLESFPEEDSVLSHSSLSSPSSTSSPEGPPAPPKQHSSTSPFPTSTPLRRITKKFVKGSTEKNKLRLQRDQERLGKQLKLRAEREEKEKLKEEAKRAKEEAKKKKEEEKELKEKERREKREKDEKEKAEKQRLKEERRKERQEALEAKLEEKRKKEEEKRLREEEKRIKAEKAEITRFFQKPKTPQAPKTLAGSCGKFAPFEIKEHMVLAPRRRTAFHPDLCSQLDQLLQQQSGEFSFLKDLKGRQPLRSGPTHVSTRNADIFNSDVVIVERGKGDGVPERRKFGRMKLLQFCENHRPAYWGTWNKKTALIRARDPWAQDTKLLDYEVDSDEEWEEEEPGESLSHSEGDDDDDMGEDEDEDDGFFVPHGYLSEDEGVTEECADPENHKVRQKLKAKEWDEFLAKGKRFRVLQPVKIGCVWAADRDCAGDDLKVLQQFAACFLETLPAQEEQTPKASKRERRDEQILAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHTGSPRSPSTTYLHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVLQSFQQEHLPVPCQWSYVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQIGAEDMDGFQADTEEEEEEEGDCMIVDVPDAAEVQAPCGAASGAGGGVGVDTGKATLTASPLGAS asf1b_human Histone chaperone ASF1B Anti-silencing function protein 1 homolog B CCG1-interacting factor A-II ASF1B protein protein human Homo sapiens Human MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI This sequence has been withdrawn from Uniprot. asf1a_human Histone chaperone ASF1A Anti-silencing function protein 1 homolog A CCG1-interacting factor A ASF1A CGI-98 HSPC146 protein protein human Homo sapiens Human MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLESHMDCM This sequence has been withdrawn from Uniprot. daxx-h3f3a-6 3245907 N/A 3245932 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3245933 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3245934 unspecified role unspecified role unspecified role unspecified role Region 183-398 Region 183-398 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false daxx-hist1h4a-1 3245908 N/A 3245935 unspecified role unspecified role prey prey Q71DI3:p.Met91Gly M91G/A mutation mutation certain certain sequence position certain certain certain sequence position certain false Q71DI3:p.Met91Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3245932 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3245934 unspecified role unspecified role bait bait Region 183-251 Region 183-251 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9UER7-1:p.Glu225Ala E225A mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false hist2h3a-chaf1a-1 3245909 N/A 3245935 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3245936 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false h3f3a-asf1b-1 3245910 N/A 3245937 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3245933 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P84243:p.Cys111Glu C111E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false daxx-h3f3a-7 3245911 N/A 3245932 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3245933 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3245934 unspecified role unspecified role unspecified role unspecified role Region 178-398 Region 178-398 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false hist2h3a-daxx-1 3245912 N/A 3245935 unspecified role unspecified role bait bait Q71DI3:p.Met91Gly M91G mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3245934 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false h3f3a-asf1a-1 3245913 N/A 3245938 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3245937 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3245933 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3245934 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false h3f3a-asf1a-2 3245914 N/A 3245938 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3245933 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3245934 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false hist2h3a-daxx-2 3245915 N/A 3245935 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false This tag was used for western bot detection. HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3245934 unspecified role unspecified role prey prey Q9UER7-1:p.Glu225Ala E225A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false daxx-h3f3a-8 3245916 N/A 3245932 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3245933 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3245934 unspecified role unspecified role unspecified role unspecified role Region 178-398 Region 178-398 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false daxx-h3f3a-9 3245917 N/A 3245932 unspecified role unspecified role prey prey P62805:p.[Thr72Ala;His76Ala] T72A/H76A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P62805:p.Tyr73Ala Y73A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3245933 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3245934 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 349-384 Region 349-384 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false h3f3a-daxx-2 3245918 N/A 3245933 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false This tag was used for western bot detection. HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3245934 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false h3f3a-chaf1a-1 3245919 N/A 3245936 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3245933 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P84243:p.Gly91Met G91M mutation mutation certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3245934 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false daxx-h3f3a-10 3245920 N/A 3245932 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3245933 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3245934 unspecified role unspecified role unspecified role unspecified role Region 178-398 Region 178-398 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false h3f3a-1 3245921 N/A 3245933 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false asf1a-h3f3a-1 3245922 N/A 3245938 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3245932 unspecified role unspecified role prey prey Region 96-103 Region 96-103 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3245933 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false h3f3a-daxx-3 3245923 N/A 3245932 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3245933 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3245934 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false h3f3a-chaf1a-2 3245924 N/A 3245936 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3245933 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P84243:p.Gly91Met G91M mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false daxx-h3f3a-11 3245925 N/A 3245932 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3245933 unspecified role unspecified role prey prey Region 1-60 Region 1-60 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P84243:p.Gly91Met G91M/D/V/L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P84243:p.Ser58Ala S58A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P84243:p.Gln94Ala Q94A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P84243:p.Glu95Ala E95A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P84243:p.Gly91Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P84243:p.Gly91Val mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P84243:p.Gly91Leu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3245934 unspecified role unspecified role bait bait Region 183-251 Region 183-251 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false Deletion of region 1-43 decreased the interaction rate/strength. h3f3a-asf1b-2 3245926 N/A 3245937 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3245933 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3245934 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false daxx-h3f3a-12 3245927 N/A 3245932 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3245933 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3245934 unspecified role unspecified role bait bait Region 183-251 Region 183-251 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9UER7-1:p.Lys229Ala K229A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9UER7-1:p.Tyr222Ala Y222A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9UER7-1:p.Tyr222Ser Y222S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9UER7-1:p.Gln206Leu Q206L mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9UER7-1:p.Glu225Leu E225L mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9UER7-1:p.Lys229Leu K229L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false hist2h3a-chaf1a-2 3245928 N/A 3245935 unspecified role unspecified role bait bait Q71DI3:p.Met91Gly M91G mutation mutation certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3245936 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3245934 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false h3f3a-daxx-4 3245929 N/A 3245933 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3245934 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false h3f3a-daxx-5 3245930 N/A 3245933 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P84243:p.Gly91Met G91M mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3245934 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false daxx-hist1h4a-2 3245931 N/A 3245935 unspecified role unspecified role prey prey Q71DI3:p.Met91Gly M91G mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3245932 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3245934 unspecified role unspecified role bait bait Region 183-251 Region 183-251 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false