DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lobingier-2012-1 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lobingier BT., Merz AJ. DIP original experiment: DIP-262182X Molecular biology of the cell 2012 IMEx Sec1/Munc18 protein Vps33 binds to SNARE domains and the quaternary SNARE complex. Lobingier BT., Merz AJ. Only protein-protein interactions imex curation lobingier-2012-2 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lobingier BT., Merz AJ. DIP original experiment: DIP-262190X Molecular biology of the cell 2012 IMEx Sec1/Munc18 protein Vps33 binds to SNARE domains and the quaternary SNARE complex. Lobingier BT., Merz AJ. Only protein-protein interactions imex curation lobingier-2012-3 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lobingier BT., Merz AJ. DIP original experiment: DIP-262186X Molecular biology of the cell 2012 IMEx Sec1/Munc18 protein Vps33 binds to SNARE domains and the quaternary SNARE complex. Lobingier BT., Merz AJ. Only protein-protein interactions imex curation lobingier-2012-4 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lobingier BT., Merz AJ. DIP original experiment: DIP-262191X Molecular biology of the cell 2012 IMEx Sec1/Munc18 protein Vps33 binds to SNARE domains and the quaternary SNARE complex. Lobingier BT., Merz AJ. Only protein-protein interactions imex curation lobingier-2012-5 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lobingier BT., Merz AJ. DIP original experiment: DIP-262183X Molecular biology of the cell 2012 IMEx Sec1/Munc18 protein Vps33 binds to SNARE domains and the quaternary SNARE complex. Lobingier BT., Merz AJ. Only protein-protein interactions imex curation lobingier-2012-6 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lobingier BT., Merz AJ. DIP original experiment: DIP-262187X Molecular biology of the cell 2012 IMEx Sec1/Munc18 protein Vps33 binds to SNARE domains and the quaternary SNARE complex. Lobingier BT., Merz AJ. Only protein-protein interactions imex curation lobingier-2012-7 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Lobingier BT., Merz AJ. DIP original experiment: DIP-262193X Molecular biology of the cell 2012 IMEx Sec1/Munc18 protein Vps33 binds to SNARE domains and the quaternary SNARE complex. Lobingier BT., Merz AJ. Only protein-protein interactions imex curation lobingier-2012-8 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lobingier BT., Merz AJ. DIP original experiment: DIP-262194X Molecular biology of the cell 2012 IMEx Sec1/Munc18 protein Vps33 binds to SNARE domains and the quaternary SNARE complex. Lobingier BT., Merz AJ. Only protein-protein interactions imex curation lobingier-2012-9 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Lobingier BT., Merz AJ. DIP original experiment: DIP-262192X Molecular biology of the cell 2012 IMEx Sec1/Munc18 protein Vps33 binds to SNARE domains and the quaternary SNARE complex. Lobingier BT., Merz AJ. Only protein-protein interactions imex curation lobingier-2012-10 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lobingier BT., Merz AJ. DIP original experiment: DIP-262184X Molecular biology of the cell 2012 IMEx Sec1/Munc18 protein Vps33 binds to SNARE domains and the quaternary SNARE complex. Lobingier BT., Merz AJ. Only protein-protein interactions imex curation lobingier-2012-11 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lobingier BT., Merz AJ. DIP original experiment: DIP-262188X Molecular biology of the cell 2012 IMEx Sec1/Munc18 protein Vps33 binds to SNARE domains and the quaternary SNARE complex. Lobingier BT., Merz AJ. Only protein-protein interactions imex curation lobingier-2012-12 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lobingier BT., Merz AJ. DIP original experiment: DIP-262189X Molecular biology of the cell 2012 IMEx Sec1/Munc18 protein Vps33 binds to SNARE domains and the quaternary SNARE complex. Lobingier BT., Merz AJ. Only protein-protein interactions imex curation lobingier-2012-13 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lobingier BT., Merz AJ. DIP original experiment: DIP-262185X Molecular biology of the cell 2012 IMEx Sec1/Munc18 protein Vps33 binds to SNARE domains and the quaternary SNARE complex. Lobingier BT., Merz AJ. Only protein-protein interactions imex curation vam3_yeast Syntaxin VAM3 VAM3 PTH1 YOR106W YOR3220W Vacuolar morphogenesis protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFFDIEAQSSKGNSQQEPQFSTNQKTKELSNLIETFAEQSRVLEKECTKIGSKRDSKELRYKIETELIPNCTSVRDKIESNILIHQNGKLSADFKNLKTKYQSLQQSYNQRKSLFPLKTPISPGTSKERKDIHPRTEAVRQDPESSYISIKVNEQSPLLHNEGQHQLQLQEEQEQQQQGLSQEELDFQTIIHQERSQQIGRIHTAVQEVNAIFHQLGSLVKEQGEQVTTIDENISHLHDNMQNANKQLTRADQHQRDRNKCGKVTLIIIIVVCMVVLLAVLS 6415D9D852C6C64D vps41_yeast Vacuolar protein sorting-associated protein 41 VPS41 FET2 Vacuolar morphogenesis protein 2 VAM2 D446 YD8554.13 YDR080W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTTDNHQNDSVLDQQSGERTIDESNSISDENNVDNKREDVNVTSPTKSVSCISQAENGVASRTDESTITGSATDAETGDDDDDDDDDDDEDEDDEDEPPLLKYTRISQLPKNFFQRDSISSCLFGDTFFAFGTHSGILHLTTCAFEPIKTIKCHRSSILCINTDGKYFATGSIDGTVIIGSMDDPQNITQYDFKRPINSVALHSNFQASRMFVSGGMAGDVVLSQRNWLGNRIDIVLNKKKKKKTRKDDLSSDMKGPIMGIYTMGDLILWMDDDGITFCDVPTRSQLLNIPFPSRIFNVQDVRPDLFRPHVHFLESDRVVIGWGSNIWLFKVSFTKDSNSIKSGDSNSQSNNMSHFNPTTNIGSLLSSAASSFRGTPDKKVELECHFTVSMLITGLASFKDDQLLCLGFDIDIEEEATIDEDMKEGKNFSKRPENLLAKGNAPELKIVDLFNGDEIYNDEVIMKNYEKLSINDYHLGKHIDKTTPEYYLISSNDAIRVQELSLKDHFDWFMERKQYYKAWKIGKYVIGSEERFSIGLKFLNSLVTKKDWGTLVDHLNIIFEETLNSLDSNSYDVTQNVLKEWADIIEILITSGNIVEIAPLIPKKPALRKSVYDDVLHYFLANDMINKFHEYITKWDLKLFSVEDFEEELETRIEAASEPTASSKEEGSNITYRTELVHLYLKENKYTKAIPHLLKAKDLRALTIIKIQNLLPQYLDQIVDIILLPYKGEISHISKLSIFEIQTIFNKPIDLLFENRHTISVARIYEIFEHDCPKSFKKILFCYLIKFLDTDDSFMISPYENQLIELYSEYDRQSLLPFLQKHNNYNVESAIEVCSSKLGLYNELIYLWGKIGETKKALSLIIDELKNPQLAIDFVKNWGDSELWEFMINYSLDKPNFTKAILTCSDETSEIYLKVIRGMSDDLQIDNLQDIIKHIVQENSLSLEVRDNILVIINDETKKFANEFLKIRSQGKLFQVDESDIEINDDLNGVL E1E48B4D5A1A4005 pep5_yeast E3 ubiquitin-protein ligase PEP5 PEP5 END1 Histone E3 ligase PEP5 Vacuolar biogenesis protein END1 Vacuolar protein sorting-associated protein 11 Vacuolar morphogenesis protein 1 Vacuolar protein-targeting protein 11 Carboxypeptidase Y-deficient protein 5 VAM1 VPL9 VPS11 VPT11 YM9959.13 YMR231W RING-type E3 ubiquitin transferase PEP5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLSSWRQFQLFENIPIRDPNFGGDSLLYSDPTLCAATIVDPQTLIIAVNSNIIKVVKLNQSQVIHEFQSFPHDFQITFLKVINGEFLVALAESIGKPSLIRVYKLEKLPNREQLYHSQVELKNGNNTYPISVVSISNDLSCIVVGFINGKIILIRGDISRDRGSQQRIIYEDPSKEPITALFLNNDATACFAATTSRILLFNTTGRNRGRPSLVLNSKNGLDLNCGSFNPATNEFICCLSNFIEFFSSSGKKHQFAFDLSLRKRIFCVDKDHILIVTEETGVPTTSISVNELSPTIINRIFIIDAKNKIISLNFVVSSAIIDIFSTSQSGKNITYLLTSEGVMHRITPKSLENQINIIIQKELYPFALQLAKQHSLSPLDVQEIHKKYGDYLFKKGLRKEATDQYIQCLDVVETSEIISKFGVKEVPDPESMRNLADYLWSLIKNSISQRDHVTLLLIVLIKLKDVEGIDTFIQHFDRKGIWNEGVVMDDMDDVTFFYSDNDFFDLDLILELMKESDFKRLSYRLAKKYSKDSLIIVDILLNLLHNPVKAIKYIKSLPIDETLRCLVTYSKKLLEESPNETNALLIEVFTGKFKPSTFEVDLDRRDTTGDFSENIRTVFYSYKTFFNYMNSNGTSDAMSESSEASHEHEEPTYHPPKPSIVFSSFVTKPFEFVVFLEACLACYQQYEGFDEDRQVILTTLYDLYLNLAQNDVPERIDDWRSRATGVLRESNKLVYSAASNNTSKRVDNSIMLLISHMDQSSASAKDKTKIDIASFANDNPEMDLLSTFRAMTLNEEPSTCLKFLEKYGTEEPKLLQVALSYFVSNKLIFKEMGGNEVLKEKVLRPIIEGERMPLLDIIKALSRTNVAHFGLIQDIIIDHVKTEDTEIKRNEKLIESYDKELKEKNKKLKNTINSDQPLHVPLKNQTCFMCRLTLDIPVVFFKCGHIYHQHCLNEEEDTLESERKLFKCPKCLVDLETSNKLFEAQHEVVEKNDLLNFALNSEEGSRDRFKVITEFLGRGAISYSDITI E5216AD3C285CF34 vps33_yeast Vacuolar protein sorting-associated protein 33 VPS33 SLP1 Protein SLP1 Vacuolar morphogenesis protein 5 VAM5 L8084.15 YLR396C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNRFWNTKKFSLTNADGLCATLNEISQNDEVLVVQPSVLPVLNSLLTFQDLTQSTPVRKITLLDDQLSDDLPSALGSVPQMDLIFLIDVRTSLRLPPQLLDAAQKHNLSSLHIIYCRWKPSFQNTLEDTEQWQKDGFDLNSKKTHFPNVIESQLKELSNEYTLYPWDLLPFPQIDENVLLTHSLYNMENVNMYYPNLRSLQSATESILVDDMVNSLQSLIFETNSIITNVVSIGNLSKRCSHLLKKRIDEHQTENDLFIKGTLYGERTNCGLEMDLIILERNTDPITPLLTQLTYAGILDDLYEFNSGIKIKEKDMNFNYKEDKIWNDLKFLNFGSIGPQLNKLAKELQTQYDTRHKAESVHEIKEFVDSLGSLQQRQAFLKNHTTLSSDVLKVVETEEYGSFNKILELELEILMGNTLNNDIEDIILELQYQYEVDQKKILRLICLLSLCKNSLREKDYEYLRTFMIDSWGIEKCFQLESLAELGFFTSKTGKTDLHITTSKSTRLQKEYRYISQWFNTVPIEDEHAADKITNENDDFSEATFAYSGVVPLTMRLVQMLYDRSILFHNYSSQQPFILSREPRVSQTEDLIEQLYGDSHAIEESIWVPGTITKKINASIKSNNRRSIDGSNGTFHAAEDIALVVFLGGVTMGEIAIMKHLQKILGKKGINKRFIIIADGLINGTRIMNSIS ED78DF55109C20E7 pep12_yeast Syntaxin PEP12 PEP12 Vacuolar protein sorting-associated protein 6 Vacuolar protein-targeting protein 13 Carboxypeptidase Y-deficient protein 12 VPS6 VPT13 OR26.29 YOR036W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEDEFFGGDNEAVWNGSRFSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDRGDVSAKVVERINKRSVAKIEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVSYSFQEFQGIQRQFTQVMKQVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIVIERDPINNEEFAYQQNLIEQRDQEISNIERGITELNEVFKDLGSVVQQQGVLVDNIEANIYTTSDNTQLASDELRKAMRYQKRTSRWRVYLLIVLLVMLLFIFLIMKL D9F5711339DA1CDA ykt6_yeast Synaptobrevin homolog YKT6 YKT6 YKL196C protein protein yeast Saccharomyces cerevisiae Baker's yeast MRIYYIGVFRSGGEKALELSEVKDLSQFGFFERSSVGQFMTFFAETVASRTGAGQRQSIEEGNYIGHVYARSEGICGVLITDKEYPVRPAYTLLNKILDEYLVAHPKEEWADVTETNDALKMKQLDTYISKYQDPSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKKSNSCCIIM 9BA0E47ED87B096D vam7_yeast Vacuolar morphogenesis protein 7 VAM7 YGL212W protein protein yeast Saccharomyces cerevisiae Baker's yeast MAANSVGKMSEKLRIKVDDVKINPKYVLYGVSTPNKRLYKRYSEFWKLKTRLERDVGSTIPYDFPEKPGVLDRRWQRRYDDPEMIDERRIGLERFLNELYNDRFDSRWRDTKIAQDFLQLSKPNVSQEKSQQHLETADEVGWDEMIRDIKLDLDKESDGTPSVRGALRARTKLHKLRERLEQDVQKKSLPSTEVTRRAALLRSLLKECDDIGTANIAQDRGRLLGVATSDNSSTTEVQGRTNNDLQQGQMQMVRDQEQELVALHRIIQAQRGLALEMNEELQTQNELLTALEDDVDNTGRRLQIANKKARHFNNSA 2F992AEC0ACBC8FE nyv1_yeast Vacuolar v-SNARE NYV1 NYV1 Synaptobrevin NYV1 New v-SNARE 1 MAM2 YLR093C protein protein yeast Saccharomyces cerevisiae Baker's yeast MKRFNVSYVEVIKNGETISSCFQPFQKNENYGTITSANEQITPVIFHNLIMDMVLPKVVPIKGNKVTKMSMNLIDGFDCFYSTDDHDPKTVYVCFTLVDMPKILPIRILSGLQEYESNATNELLSSHVGQILDSFHEELVEYRNQTLNSSGNGQSSNGNGQNTISDIGDATEDQIKDVIQIMNDNIDKFLERQERVSLLVDKTSQLNSSSNKFRRKAVNIKEIMWWQKVKNITLLTFTIILFVSAAFMFFYLW 494B587CF0F85997 vti1_yeast t-SNARE VTI1 VTI1 Qb-SNARE VTI1 Vesicle transport v-SNARE protein VTI1 VPS10-interacting protein 1 YM9646.10C YMR197C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDSGDRDRLFGDLNASNIDDDQRQQLLSNHAILQKSGDRLKDASRIANETEGIGSQIMMDLRSQRETLENARQTLFQADSYVDKSIKTLKTMTRRLVANKFISYAIIAVLILLILLVLFSKFK E55B4DA3B40FAD67 pep3_yeast Vacuolar membrane protein PEP3 VAM8 VPS18 VPT18 L9634.2 YLR148W PEP3 Vacuolar protein sorting-associated protein 18 Vacuolar morphogenesis protein 8 Vacuolar protein-targeting protein 18 Carboxypeptidase Y-deficient protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIKTRIEEVQLQFLTGNTELTHLKVSNDQLIVTTQRTIYRINLQDPAIVNHFDCPLSKELETIMNVHVSPMGSVILIRTNFGRYMLLKDGEFTQLNKIKNLDLSSLHWINETTFLMGIKKTPKLYRVELTGKDITTKLWYENKKLSGGIDGIAYWEGSLLLTIKDNILYWRDVTNMKFPLVLPDESEQFERLKHHAIKKFDSYNGLFAWVTSNGIVFGDLKEKQMEKDPASNNFGKFLSSSKVLLNFELPDYQNDKDHLIKDIVLTAFHILLLRKNTVTMVSQLNNDVVFHETIPRHQLTGSNTDSNEKFLGLVRDSVKETFWCFSNINVFEIIIENEPNSVWNLLVRDNKFDKALSLKGLTVREIESVKLSKAMYLFHTAKDFHSAAQTLGSMKDLSHFGEIALNFLQIKDYNDLNVILIKQLDNVPWKSTQVVLSSWIIWNFMKQLNDIELKINTTKPASTDEDNLLNWNLNLKEKSNELTKFLESHLEKLDNETVYQIMSKQNRQNELLIFASLINDMKFLLSFWIDQGNWYESLKILLTINNHDLVYKYSLILLLNSPEATVSTWMKIKDLDPNKLIPTILKFFTNWQNNSKLITNISEYPENYSLTYLKWCVREVPKMCNPIVYNSILYMMITDPRNDMILENDIIKFMKSNENKYDLNFQLRLSLKFKKTKTSIFLLTRLNLFEDAIDLALKNNLIDDCKVIVNDEILIEDYKLRKRLWLKIAKHLLLSMKDIDIKQLIRTILNDSNEILTIKDLLPFFNEYTTIANLKEELIKFLENHNMKMNEISEDIINSKNLKVEINTEISKFNEIYRILEPGKSCDECGKFLQIKKFIVFPCGHCFHWNCIIRVILNSNDYNLRQKTENFLKAKSKHNLNDLENIIVEKCGLCSDININKIDQPISIDETELAKWNE 37AE3C34AE0470B8 vam3p-vps11p-1 3245577 N/A 3245590 unspecified role unspecified role bait bait 1-145 binding domain 1-145 binding domain sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3245591 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3245592 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3245593 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false pep12p-vps33p-1 3245578 N/A 3245594 unspecified role unspecified role bait bait 1-268 binding domain 1-268 binding domain sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3245593 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false vam3p-vps33p-2 3245579 N/A 3245593 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3245590 unspecified role unspecified role bait bait 182-264 binding domain 182-264 binding domain sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false ykt6p-vps33p-1 3245580 N/A 3245595 unspecified role unspecified role bait bait 1-195 binding region 1-195 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3245593 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false vam3p-vps33p-3 3245581 N/A 3245593 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3245590 unspecified role unspecified role bait bait 182-264 binding domain 182-264 binding domain sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false vam7p-vps33p-1 3245582 N/A 3245596 unspecified role unspecified role bait bait 190-316 binding region 190-316 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3245593 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false vam3p-nyv1p-3 3245583 N/A 3245597 unspecified role unspecified role prey prey 1-231 binding region 1-231 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3245596 unspecified role unspecified role prey prey 190-316 binding region 190-316 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3245598 unspecified role unspecified role prey prey 1-194 binding region 1-194 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3245590 unspecified role unspecified role bait bait 182-264 binding domain 182-264 binding domain sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli association association false false false vam3p-vps33p-4 3245584 N/A 3245593 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3245590 unspecified role unspecified role bait bait 182-243 binding domain 182-243 binding domain sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false vam3p-nyv1p-4 3245585 N/A 3245597 unspecified role unspecified role prey prey 1-231 binding region 1-231 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3245596 unspecified role unspecified role prey prey 190-316 binding region 190-316 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3245598 unspecified role unspecified role prey prey 1-194 binding region 1-194 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3245593 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3245590 unspecified role unspecified role bait bait 182-264 binding domain 182-264 binding domain sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli association association false false false vam3p-vps18p-1 3245586 N/A 3245599 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3245593 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3245590 unspecified role unspecified role bait bait 182-264 binding domain 182-264 binding domain sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli association association false false false nyv1p-vps33p-1 3245587 N/A 3245597 unspecified role unspecified role bait bait 162-231 binding region 162-231 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3245593 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false vam7p-vps33p-2 3245588 N/A 3245596 unspecified role unspecified role bait bait 190-316 binding region 190-316 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3245593 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false vam3p-vps33p-5 3245589 N/A 3245593 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3245590 unspecified role unspecified role bait bait 199-264 binding domain 199-264 binding domain sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false