DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lin-2012-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lin Y., Li Y., Zhu Y., Zhang J., Li Y., Liu X., Jiang W., Yu S., You XF., Xiao C., Hong B., Wang Y., Jiang JD., Si S. DIP original experiment: DIP-251807X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Identification of antituberculosis agents that target ribosomal protein interactions using a yeast two-hybrid system. Lin Y., Li Y., Zhu Y., Zhang J., Li Y., Liu X., Jiang W., Yu S., You XF., Xiao C., Hong B., Wang Y., Jiang JD., Si S. Only protein-protein interactions imex curation lin-2012-12 ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds weight by comassie molecular weight estimation by coomasie staining weight by comassie Lin Y., Li Y., Zhu Y., Zhang J., Li Y., Liu X., Jiang W., Yu S., You XF., Xiao C., Hong B., Wang Y., Jiang JD., Si S. DIP original experiment: DIP-251810X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Identification of antituberculosis agents that target ribosomal protein interactions using a yeast two-hybrid system. Lin Y., Li Y., Zhu Y., Zhang J., Li Y., Liu X., Jiang W., Yu S., You XF., Xiao C., Hong B., Wang Y., Jiang JD., Si S. Only protein-protein interactions imex curation lin-2012-13 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lin Y., Li Y., Zhu Y., Zhang J., Li Y., Liu X., Jiang W., Yu S., You XF., Xiao C., Hong B., Wang Y., Jiang JD., Si S. DIP original experiment: DIP-251808X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Identification of antituberculosis agents that target ribosomal protein interactions using a yeast two-hybrid system. Lin Y., Li Y., Zhu Y., Zhang J., Li Y., Liu X., Jiang W., Yu S., You XF., Xiao C., Hong B., Wang Y., Jiang JD., Si S. Only protein-protein interactions imex curation lin-2012-14 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lin Y., Li Y., Zhu Y., Zhang J., Li Y., Liu X., Jiang W., Yu S., You XF., Xiao C., Hong B., Wang Y., Jiang JD., Si S. DIP original experiment: DIP-251809X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Identification of antituberculosis agents that target ribosomal protein interactions using a yeast two-hybrid system. Lin Y., Li Y., Zhu Y., Zhang J., Li Y., Liu X., Jiang W., Yu S., You XF., Xiao C., Hong B., Wang Y., Jiang JD., Si S. Only protein-protein interactions imex curation rl7_myctu 50S ribosomal protein L7/L12 rplL MTCY20H10.33 Rv0652 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAKLSTDELLDAFKEMTLLELSDFVKKFEETFEVTAAAPVAVAAAGAAPAGAAVEAAEEQSEFDVILEAAGDKKIGVIKVVREIVSGLGLKEAKDLVDGAPKPLLEKVAKEAADEAKAKLEAAGATVTVK EC2EF7E7E50F43ED rl10_myctu 50S ribosomal protein L10 rplJ MTCY20H10.32 Rv0651 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MARADKATAVADIAAQFKESTATLITEYRGLTVANLAELRRSLTGSATYAVAKNTLIKRAASEAGIEGLDELFVGPTAIAFVTGEPVDAAKAIKTFAKEHKALVIKGGYMDGHPLTVAEVERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQLARLAAALQEKKACPGPDSAE This sequence has been withdrawn from Uniprot. 48CB571C1A9B801D l10-l12-1 3245560 N/A 3245564 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3245565 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false l12-1 3245561 N/A 3245564 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false l10-l12-2 3245562 N/A 3245564 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3245565 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false l12-l10-1 3245563 N/A 3245564 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3245565 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false