DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ agarwal-2012-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Agarwal V., Lin S., Lukk T., Nair SK., Cronan JE. DIP original experiment: DIP-253617X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of the enzyme-acyl carrier protein (ACP) substrate gatekeeper complex required for biotin synthesis. Agarwal V., Lin S., Lukk T., Nair SK., Cronan JE. Only protein-protein interactions imex curation agarwal-2012-4 in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Agarwal V., Lin S., Lukk T., Nair SK., Cronan JE. DIP original experiment: DIP-253618X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of the enzyme-acyl carrier protein (ACP) substrate gatekeeper complex required for biotin synthesis. Agarwal V., Lin S., Lukk T., Nair SK., Cronan JE. Only protein-protein interactions imex curation agarwal-2012-5 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Agarwal V., Lin S., Lukk T., Nair SK., Cronan JE. DIP original experiment: DIP-253619X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of the enzyme-acyl carrier protein (ACP) substrate gatekeeper complex required for biotin synthesis. Agarwal V., Lin S., Lukk T., Nair SK., Cronan JE. Only protein-protein interactions imex curation acp_ecoli Acyl carrier protein acpP b1094 JW1080 Cytosolic-activating factor Fatty acid synthase acyl carrier protein protein protein ecoli Escherichia coli (strain K12) MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA bioh_ecoli Pimeloyl-[acyl-carrier protein] methyl ester esterase Biotin synthesis protein BioH bioH bioB b3412 JW3375 Carboxylesterase BioH protein protein ecoli Escherichia coli (strain K12) MNNIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLADMAEAVLQQAPDKAIWLGWSLGGLVASQIALTHPERVQALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARALKKTVLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWPHSESYIFAKAAHAPFISHPAEFCHLLVALKQRV acpp-bioh-1 3245539 N/A 3245542 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3245543 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false acpp-bioh-2 3245540 N/A 3245542 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3245543 unspecified role unspecified role unspecified role unspecified role P13001:p.Ser82Ala S82A mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false acpp-bioh-3 3245541 N/A 3245542 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3245543 enzyme enzyme unspecified role unspecified role P13001:p.Ser82Ala S82A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P13001:p.[Arg138Ala;Arg142Ala;Arg155Ala] R138A/R142A/R155A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P13001:p.[Arg138Ala;Arg142Ala;Arg159Ala] R138A/R142A/R159A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P13001:p.[Arg138Ala;Arg142Ala;Arg155Ala;Arg159Ala] R138A/R142A/R155A/R159A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P13001:p.[Arg142Ala;Arg155Ala;Arg159Ala] R142A/R155A/R159A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P13001:p.[Arg138Ala;Arg155Ala;Arg159Ala] R138A/R155A/R159A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false