DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bggild-2012-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bøggild A., Sofos N., Andersen KR., Feddersen A., Easter AD., Passmore LA., Brodersen DE. DIP original experiment: DIP-251033X Structure (London, England : 1993) 2012 IMEx The crystal structure of the intact E. coli RelBE toxin-antitoxin complex provides the structural basis for conditional cooperativity. Bøggild A., Sofos N., Andersen KR., Feddersen A., Easter AD., Passmore LA., Brodersen DE. Only protein-protein interactions imex curation bggild-2012-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bøggild A., Sofos N., Andersen KR., Feddersen A., Easter AD., Passmore LA., Brodersen DE. DIP original experiment: DIP-251030X Structure (London, England : 1993) 2012 IMEx The crystal structure of the intact E. coli RelBE toxin-antitoxin complex provides the structural basis for conditional cooperativity. Bøggild A., Sofos N., Andersen KR., Feddersen A., Easter AD., Passmore LA., Brodersen DE. Only protein-protein interactions imex curation bggild-2012-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bøggild A., Sofos N., Andersen KR., Feddersen A., Easter AD., Passmore LA., Brodersen DE. DIP original experiment: DIP-251034X Structure (London, England : 1993) 2012 IMEx The crystal structure of the intact E. coli RelBE toxin-antitoxin complex provides the structural basis for conditional cooperativity. Bøggild A., Sofos N., Andersen KR., Feddersen A., Easter AD., Passmore LA., Brodersen DE. Only protein-protein interactions imex curation bggild-2012-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bøggild A., Sofos N., Andersen KR., Feddersen A., Easter AD., Passmore LA., Brodersen DE. DIP original experiment: DIP-251031X Structure (London, England : 1993) 2012 IMEx The crystal structure of the intact E. coli RelBE toxin-antitoxin complex provides the structural basis for conditional cooperativity. Bøggild A., Sofos N., Andersen KR., Feddersen A., Easter AD., Passmore LA., Brodersen DE. Only protein-protein interactions imex curation bggild-2012-5 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Bøggild A., Sofos N., Andersen KR., Feddersen A., Easter AD., Passmore LA., Brodersen DE. DIP original experiment: DIP-251032X Structure (London, England : 1993) 2012 IMEx The crystal structure of the intact E. coli RelBE toxin-antitoxin complex provides the structural basis for conditional cooperativity. Bøggild A., Sofos N., Andersen KR., Feddersen A., Easter AD., Passmore LA., Brodersen DE. Only protein-protein interactions imex curation rele_ecoli mRNA interferase toxin RelE relE b1563 JW1555 Endoribonuclease RelE Toxin RelE protein protein ecoli Escherichia coli (strain K12) MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKRERSEVYSEAVKRIL This sequence has been withdrawn from Uniprot. relb_ecoli Antitoxin RelB relB b1564 JW1556 protein protein ecoli Escherichia coli (strain K12) MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL relb-rele-1 3244972 N/A 3244977 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3244978 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false relb-rele-2 3244973 N/A 3244977 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3244978 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rele-1 3244974 N/A 3244977 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false relb-4 3244975 N/A 3244978 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false relb-rele-3 3244976 N/A 3244977 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3244978 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false