DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ schrter-2011-1 in vitro In vitro solid phase assay solid phase assay tag fluorescence tag visualisation by fluorescence tag fluorescence Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250580X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-2 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250563X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-3 in vitro In vitro solid phase assay solid phase assay tag fluorescence tag visualisation by fluorescence tag fluorescence Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250584X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-4 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250567X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-5 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250571X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-6 in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250575X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-7 in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250579X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-8 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250564X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-9 in vitro In vitro solid phase assay solid phase assay tag fluorescence tag visualisation by fluorescence tag fluorescence Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250583X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-10 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250568X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-11 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250572X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-12 in vitro In vitro solid phase assay solid phase assay tag fluorescence tag visualisation by fluorescence tag fluorescence Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250576X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-13 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250565X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-14 in vitro In vitro solid phase assay solid phase assay tag fluorescence tag visualisation by fluorescence tag fluorescence Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250582X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-15 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250569X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-16 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250573X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-17 in vitro In vitro solid phase assay solid phase assay tag fluorescence tag visualisation by fluorescence tag fluorescence Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250577X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-18 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250566X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-19 in vitro In vitro solid phase assay solid phase assay tag fluorescence tag visualisation by fluorescence tag fluorescence Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250581X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-20 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250570X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-21 in vitro In vitro solid phase assay solid phase assay tag fluorescence tag visualisation by fluorescence tag fluorescence Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250585X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-22 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250574X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation schrter-2011-23 in vitro In vitro solid phase assay solid phase assay tag fluorescence tag visualisation by fluorescence tag fluorescence Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. DIP original experiment: DIP-250578X PLoS biology 2011 IMEx Topology and dynamics of the zebrafish segmentation clock core circuit. Schröter C., Ares S., Morelli LG., Isakova A., Hens K., Soroldoni D., Gajewski M., Jülicher F., Maerkl SJ., Deplancke B., Oates AC. Only protein-protein interactions imex curation q6p0j1_danre hes6 her13.2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MAPASRSNTHDEDNYGIKDRKTRKPLVEKKRRARINESLQELRLLLADPDAQVKMENAEVLEMTVKRVESILQNKAKEADSVNREANERFAAGYIQCMHEVHTFVSSCPGIDATIAADLLNHLLECMPLNDEERFQDILSDLISDSNNSGTWPGEAAYATLSPGGTSVANGGSSALSPAPSTTSSDDICSDLDDTDTEHSRISVDAGDQAPVVPTLYTNKSIWRPW C054411323B4B21E myod1_danre Myoblast determination protein 1 homolog myod1 myod Myogenic factor 1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MELSDIPFPIPSADDFYDDPCFNTNDMHFFEDLDPRLVHVSLLKPDEHHHIEDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNDAFETLKRCTSTNPNQRLPKVEILRNAISYIESLQALLRSQEDNYYPVLEHYSGDSDASSPRSNCSDGMMDFMGPTCQTRRRNSYDSSYFNDTPNADARNNKNSVVSSLDCLSSIVERISTETPACPVLSVPEGHEESPCSPHEGSVLSDTGTTAPSPTSCPQQQAQETIYQVL q90463_danre her1 HER-1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MVTPKMASRRPTKRILKPVIEKKRRDRINQRLEELRTLLLDNTLDSRLQNPKLEKAEILELAVEYIRTKTATARDQGDSSKDTHDPKPPPLLSRRPQMPCASIPESIQTHNSPSNPIYKAGFKECISRSASFIDCVEPSQRDSFVQGLCHHLDSYSSALPHGRVSSNPTHHPWIPNPELSCRTDVQSIGHMRANPEPYSYANSLYPKSFMHLHPTGQHPYLSPPYSISPPPSPGFSSSSPPFSSSPTYLSVPCQFPFPPSISPHSTDSSSSSTLSTVSLSTTSLPVVPGPHLQVSSPTRVRFSGSVQSSQPRTLRRALFHNQPLWRPW D214F1B562126041 q9i9k1_danre her7 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MKILAQTEKIKMDRKLLKPQVERRRRERMNRSLENLKLLLLQGPEHNQPNQRRLEKAEILEYTVLFLQKANEASKEEEGEEKSQFMEGFSSCLQKAARFLLEEGGLEGSVTSMLCQRLAHPTIRLPVRGHSRKQHAESNPQHHARRPHHKNTVSKAGHPSACRNTKEPQASRAAFRSTDSNTKHSTAQPTSRHPEPASQTVWRPWP 3A3083A4B5F5708F hes6-hes6-1 3244017 N/A 3244040 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244040 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false her1-myod1-1 3244018 N/A 3244041 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244042 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false her1-her1-1 3244019 N/A 3244042 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244042 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false her7-her1-1 3244020 N/A 3244043 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244042 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false hes6-her7-1 3244021 N/A 3244040 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244043 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false her7-her1-2 3244022 N/A 3244043 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244042 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false hes6-her7-2 3244023 N/A 3244040 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244043 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false her1-her1-2 3244024 N/A 3244042 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244042 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false her1-myod1-2 3244025 N/A 3244041 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244042 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false her7-myod1-1 3244026 N/A 3244041 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244043 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false hes6-hes6-2 3244027 N/A 3244040 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244040 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false her7-myod1-2 3244028 N/A 3244041 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244043 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false her1-her7-1 3244029 N/A 3244043 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244042 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false hes6-myod1-1 3244030 N/A 3244041 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244040 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false her7-hes6-1 3244031 N/A 3244040 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244043 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false hes6-her1-1 3244032 N/A 3244042 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244040 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false her7-hes6-2 3244033 N/A 3244040 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244043 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false her1-hes6-1 3244034 N/A 3244040 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244042 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false hes6-her1-2 3244035 N/A 3244042 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244040 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false her7-her7-1 3244036 N/A 3244043 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244043 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false her1-her7-2 3244037 N/A 3244043 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244042 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false hes6-myod1-2 3244038 N/A 3244041 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244040 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false her7-her7-2 3244039 N/A 3244043 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3244043 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false