DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ huber-2012-4 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Huber EM., Scharf DH., Hortschansky P., Groll M., Brakhage AA. DIP original experiment: DIP-250987X Structure (London, England : 1993) 2012 IMEx DNA minor groove sensing and widening by the CCAAT-binding complex. Huber EM., Scharf DH., Hortschansky P., Groll M., Brakhage AA. Only protein-protein interactions imex curation huber-2012-5 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Huber EM., Scharf DH., Hortschansky P., Groll M., Brakhage AA. DIP original experiment: DIP-250984X Structure (London, England : 1993) 2012 IMEx DNA minor groove sensing and widening by the CCAAT-binding complex. Huber EM., Scharf DH., Hortschansky P., Groll M., Brakhage AA. Only protein-protein interactions imex curation huber-2012-6 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Huber EM., Scharf DH., Hortschansky P., Groll M., Brakhage AA. DIP original experiment: DIP-250986X Structure (London, England : 1993) 2012 IMEx DNA minor groove sensing and widening by the CCAAT-binding complex. Huber EM., Scharf DH., Hortschansky P., Groll M., Brakhage AA. Only protein-protein interactions imex curation huber-2012-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Huber EM., Scharf DH., Hortschansky P., Groll M., Brakhage AA. DIP original experiment: DIP-250985X Structure (London, England : 1993) 2012 IMEx DNA minor groove sensing and widening by the CCAAT-binding complex. Huber EM., Scharf DH., Hortschansky P., Groll M., Brakhage AA. Only protein-protein interactions imex curation q00735_emend hapC protein protein emend Emericella nidulans Aspergillus nidulans MSSTSPSKEPEVEQEPHSGEEHEQMDKEQDNQTQGQGEFEVKEQDRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEASEKCQQEKRKTVNGEDILFAMTSLGFENYAEALKIYLSKYRETQSARGEHQNRPPSSGYAGGDPSAELPAALQSCVPGVLQLEAPSPKPLIMQAAL p87092_emend hapE protein protein emend Emericella nidulans Aspergillus nidulans MEQAQQTSGQQQGRQQPVYDTRQGGHYGASAALAAQGFAPVAELYTGTWANVNQGLQGTARDILTTYWQHVINHLESDNHDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDIAAALSKSDMFDFLIDIVPREEATSHAKRSSQSAGAPAGPGGPTAAGQLPQTQHGVQHHPHHMAPPDYGALGQHPLQDQEYRQQTMYGGAVQSDPTAAYAQPQTQMFEGMYTAYPHLPPQQ p87249_emend Transcriptional activator HAP2 hapB protein protein emend Emericella nidulans Aspergillus nidulans MEYSPQYQQQHGQHPHPASHMTGAYPTAPQNPGSALGSMTSPTNPQTHIQQAHPTHQASPVVPSQSHYQQAQNAPGSMHQQMNFPQSYGVTTAMPPQPYGISPTQAAAMATAAASGQFYPTHGDSIAGQMAQGPRGSPRMAGVPVKTDRNPRSPPQIPGQMPPMGSQVPLTPTAQMQQRRMSHVGSPHVQNAQPVMNHVGRPSVPPPMPPPQHPVQQTQTSPDMMPSGAEESPLYVNAKQFHRILKRRVARQKLEEQLRLTSKGRKPYLHESRHNHAMRRPRGPGGRFLTADEVAAMEKKNAAGGQENADPNASKAVSDSSPASQKRKASDGNNENPNSAKKAKTGAQKASNNADESEAESGGPSDEDG hapb-hapc-1 3243792 N/A 3243796 unspecified role unspecified role prey prey Region 42-132 Region 42-132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3243797 unspecified role unspecified role prey prey Region 47-164 Region 47-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3243798 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 231-269 Region 231-269 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false hapb-hapc-2 3243793 N/A 3243796 unspecified role unspecified role unspecified role unspecified role Region 42-132 Region 42-132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3243797 unspecified role unspecified role unspecified role unspecified role Region 47-164 Region 47-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3243798 unspecified role unspecified role unspecified role unspecified role Region 231-293 Region 231-293 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false hapb-hapc-3 3243794 N/A 3243796 unspecified role unspecified role prey prey Region 42-132 Region 42-132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3243797 unspecified role unspecified role prey prey Region 47-164 Region 47-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3243798 unspecified role unspecified role bait bait Region 231-280 Region 231-280 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli association association false false false hapb-hapc-4 3243795 N/A 3243796 unspecified role unspecified role unspecified role unspecified role Region 42-132 Region 42-132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3243797 unspecified role unspecified role unspecified role unspecified role Region 47-164 Region 47-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3243798 unspecified role unspecified role unspecified role unspecified role Region 231-269 Region 231-269 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false