DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ shim-2012-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shim AH., Chang RA., Chen X., Longnecker R., He X. DIP original experiment: DIP-251752X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1. Shim AH., Chang RA., Chen X., Longnecker R., He X. Only protein-protein interactions imex curation shim-2012-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Shim AH., Chang RA., Chen X., Longnecker R., He X. DIP original experiment: DIP-251750X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1. Shim AH., Chang RA., Chen X., Longnecker R., He X. Only protein-protein interactions imex curation shim-2012-5 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Shim AH., Chang RA., Chen X., Longnecker R., He X. DIP original experiment: DIP-251753X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1. Shim AH., Chang RA., Chen X., Longnecker R., He X. Only protein-protein interactions imex curation shim-2012-6 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Shim AH., Chang RA., Chen X., Longnecker R., He X. DIP original experiment: DIP-251751X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1. Shim AH., Chang RA., Chen X., Longnecker R., He X. Only protein-protein interactions imex curation barf1_ebvg Secreted protein BARF1 BARF1 33 kDa early protein p33 protein protein ebvg Epstein-Barr virus (strain B95-8) Human herpesvirus 4 MARFIAQLLLLASCVAAGQAVTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLSQ csf1_human Macrophage colony-stimulating factor 1 CSF1 Lanimostim protein protein human Homo sapiens Human MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMGTNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPADVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLSAQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTGHERQSEGSFSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQVELPV csf1r_mouse Macrophage colony-stimulating factor 1 receptor Csf1r Csfmr Fms CSF-1 receptor Proto-oncogene c-Fms protein protein mouse Mus musculus Mouse MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDESLFTPVVVACMSVMSLLVLLLLLLLYKYKQKPKYQVRWKIIERYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDSEGDSSYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSSDSFFKQDLDKEASRPLELWDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTSGHVAKIGDFGLARDIMNDSNYVVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNNKFYKLVKDGYQMAQPVFAPKNIYSIMQSCWDLEPTRRPTFQQICFLLQEQARLERRDQDYANLPSSGGSSGSDSGGGSSGGSSSEPEEESSSEHLACCEPGDIAQPLLQPNNYQFC barf1-csf1-1 3242967 N/A 3242971 unspecified role unspecified role unspecified role unspecified role Region 19-221 Region 19-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3242972 unspecified role unspecified role unspecified role unspecified role Region 36-182 Region 36-182 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false barf1-csf1-2 3242968 N/A 3242971 unspecified role unspecified role unspecified role unspecified role Region 19-221 Region 19-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3242972 unspecified role unspecified role unspecified role unspecified role Region 36-182 Region 36-182 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false csf1-csf1r-20 3242969 N/A 3242973 unspecified role unspecified role unspecified role unspecified role Region 20-511 Region 20-511 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3242972 unspecified role unspecified role unspecified role unspecified role Region 36-182 Region 36-182 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false barf1-csf1-3 3242970 N/A 3242971 unspecified role unspecified role unspecified role unspecified role Region 19-221 Region 19-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3242972 unspecified role unspecified role unspecified role unspecified role Region 36-182 Region 36-182 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false