IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ logsdon-2012-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Logsdon NJ., Deshpande A., Harris BD., Rajashankar KR., Walter MR., Logsdon NJ., Deshpande A., Harris BD., Rajashankar KR., Walter MR. The authors have stated that IL19 and IL22 are of Human origin. walter@uab.edu Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation The "soluble domains" of proteins have been assumed to be the extracellular domains, with residue numbering used as quoted in main methods section. Sequences and further details of constructs used were taken from (or confirmed in) a patent by the last author of this publication:WO2014011732A1 (https://encrypted.google.com/patents/WO2014011732A1?cl=en) Only protein-protein interactions logsdon-2012-3 in vitro In vitro crosslink cross-linking study crosslink weight by staining molecular weight estimation by staining weight by staining Logsdon NJ., Deshpande A., Harris BD., Rajashankar KR., Walter MR., Logsdon NJ., Deshpande A., Harris BD., Rajashankar KR., Walter MR. Crosslinker was glutaraldehyde. The authors have stated that IL19 and IL22 are of Human origin. walter@uab.edu Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation The "soluble domains" of proteins have been assumed to be the extracellular domains, with residue numbering used as quoted in main methods section. Sequences and further details of constructs used were taken from (or confirmed in) a patent by the last author of this publication:WO2014011732A1 (https://encrypted.google.com/patents/WO2014011732A1?cl=en) Only protein-protein interactions logsdon-2012-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Logsdon NJ., Deshpande A., Harris BD., Rajashankar KR., Walter MR., Logsdon NJ., Deshpande A., Harris BD., Rajashankar KR., Walter MR. The authors have stated that IL19 and IL22 are of Human origin. walter@uab.edu Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation The "soluble domains" of proteins have been assumed to be the extracellular domains, with residue numbering used as quoted in main methods section. Sequences and further details of constructs used were taken from (or confirmed in) a patent by the last author of this publication:WO2014011732A1 (https://encrypted.google.com/patents/WO2014011732A1?cl=en) Only protein-protein interactions i20ra_human Interleukin-20 receptor subunit alpha IL20RA Cytokine receptor class-II member 8 Cytokine receptor family 2 member 8 IL-20R1 ZcytoR7 UNQ681/PRO1315 protein protein human Homo sapiens Human MRAPGRPALRPLPLPPLLLLLLAAPWGRAVPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAKIIFWYVLPVSITVFLFSVMGYSIYRYIHVGKEKHPANLILIYGNEFDKRFFVPAEKIVINFITLNISDDSKISHQDMSLLGKSSDVSSLNDPQPSGNLRPPQEEEEVKHLGYASHLMEIFCDSEENTEGTSLTQQESLSRTIPPDKTVIEYEYDVRTTDICAGPEEQELSLQEEVSTQGTLLESQAALAVLGPQTLQYSYTPQLQDLDPLAQEHTDSEEGPEEEPSTTLVDWDPQTGRLCIPSLSSFDQDSEGCEPSEGDGLGEEGLLSRLYEEPAPDRPPGENETYLMQFMEEWGLYVQMEN i20rb_human Interleukin-20 receptor subunit beta Fibronectin type III domain containing 6 IL-20R2 UNQ557/PRO1114 IL20RB DIRS1 protein protein human Homo sapiens Human MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPLVLALFAFVGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVMSPEELLRAWIS q9nyy1-pro_0000015381 Interleukin-20 Cytokine Zcyto10 IL20 ZCYTO10 UNQ852/PRO1801 protein protein human Homo sapiens Human LKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE 25 176 q9uhd0-pro_0000015379 Interleukin-19 Melanoma differentiation-associated protein-like protein IL19 ZMDA1 NG.1 protein protein human Homo sapiens Human LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA 25 177 i22r1_human Interleukin-22 receptor subunit alpha-1 IL22RA1 IL22R Cytokine receptor class-II member 9 Cytokine receptor family 2 member 9 ZcytoR11 protein protein human Homo sapiens Human MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMGFLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWES il20-il20ra-1 2959832 N/A 2959835 unspecified role unspecified role prey prey extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9UHF4:p.[Lys111Arg;Lys113Arg] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9UHF4:p.[Ser190Ala;Trp194Ala;Trp207Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959836 unspecified role unspecified role bait bait Q6UXL0:p.[Asn40Gln;Asn134Gln] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959837 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 physical association physical association false false false 2959832 Fig 5B, 6F, table S6 il20rb-il20-1 2959832 N/A 2959836 unspecified role unspecified role bait bait Q6UXL0:p.[Asn40Gln;Asn134Gln] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959837 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 direct interaction direct interaction false false false 2959832 6D, table S6 il20rb-il20-2 2959832 N/A 2959835 unspecified role unspecified role bait bait c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9UHF4:p.[Lys111Arg;Lys113Arg] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959837 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 direct interaction direct interaction false false false 2959832 6B, table S6 il20rb-il20-5 2959832 N/A 2959837 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959835 unspecified role unspecified role bait bait extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9UHF4:p.[Lys111Arg;Lys113Arg] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959836 unspecified role unspecified role prey prey extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q6UXL0:p.[Asn40Gln;Asn134Gln] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 physical association physical association false false false 2959832 Supp Fig 5A il20rb-il20-6 2959832 N/A 2959838 unspecified role unspecified role prey prey Stoichiometry: 1.0 N/A 2959835 unspecified role unspecified role prey prey Q9UHF4:p.[Ser190Ala;Trp194Ala;Trp207Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9UHF4:p.[Lys111Arg;Lys113Arg] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959836 unspecified role unspecified role bait bait extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q6UXL0:p.[Asn40Gln;Asn134Gln] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 physical association physical association false false false 2959832 Fig 6E, 5B, table S6 This interaction is also shown in figure 5B, but it is not stated if an Fc tag was present on IL20R2, and no Kd value is given in Table S6. In Figure 5B no difference is shown between IL19 alone, and IL19 plus IL20R1 3M mutant. il20rb-il20-8 2959832 N/A 2959836 unspecified role unspecified role bait bait Q6UXL0:p.[Asn40Gln;Asn134Gln] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959837 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 direct interaction direct interaction false false false 2959832 5B, table S6-row2 il20rb-il20-9 2959832 N/A 2959836 unspecified role unspecified role bait bait Q6UXL0:p.[Asn40Gln;Asn134Gln] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959838 unspecified role unspecified role prey prey Stoichiometry: 1.0 direct interaction direct interaction false false false 2959832 5B, table S6-row1 il20rb-il19-1 2959832 N/A 2959836 unspecified role unspecified role bait bait c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q6UXL0:p.[Asn40Gln;Asn134Gln] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959838 unspecified role unspecified role prey prey Stoichiometry: 1.0 direct interaction direct interaction false false false 2959832 6C, table S6 il20rb-il20-7 2959832 N/A 2959839 unspecified role unspecified role prey prey possible_extracellular_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959836 unspecified role unspecified role bait bait Q6UXL0:p.[Asn40Gln;Asn134Gln] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959837 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 physical association physical association false false false 2959832 6H, table S6 il20ra-il20-1 2959832 N/A 2959837 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959839 unspecified role unspecified role bait bait possible_extracellular_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 N/A 2959836 unspecified role unspecified role prey prey extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q6UXL0:p.[Asn40Gln;Asn134Gln] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 physical association physical association false false false 2959832 Supp Fig 5C il20rb-il20-3 2959833 N/A 2959835 unspecified role unspecified role neutral component neutral component extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9UHF4:p.[Lys111Arg;Lys113Arg] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 2.0 N/A 2959837 unspecified role unspecified role neutral component neutral component drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 2.0 N/A 2959835 unspecified role unspecified role neutral component neutral component extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9UHF4:p.[Lys111Arg;Lys113Arg] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 2.0 physical association physical association false false false Supp. fig 4C il20rb-il20-4 2959833 N/A 2959836 unspecified role unspecified role bait bait Q6UXL0:p.[Asn40Gln;Asn134Gln] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959837 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 physical association physical association false false false Supp fig 4C il20rb-il20-10 2959833 N/A 2959836 unspecified role unspecified role bait bait Q6UXL0:p.[Asn40Gln;Asn134Gln] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959838 unspecified role unspecified role prey prey Stoichiometry: 1.0 physical association physical association false false false Supp fig 4 A/B il20-il20ra-3 2959833 N/A 2959835 unspecified role unspecified role neutral component neutral component extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9UHF4:p.[Lys111Arg;Lys113Arg] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 2.0 N/A 2959838 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 N/A 2959835 unspecified role unspecified role neutral component neutral component extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9UHF4:p.[Lys111Arg;Lys113Arg] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 2.0 physical association physical association false false false Supp. fig 4B il20-il20ra-2 2959834 N/A 2959835 unspecified role unspecified role neutral component neutral component extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9UHF4:p.[Lys111Arg;Lys113Arg] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959836 unspecified role unspecified role neutral component neutral component Q6UXL0:p.[Asn40Gln;Asn134Gln] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 N/A 2959837 unspecified role unspecified role neutral component neutral component drome Drosophila melanogaster (Fruit fly) Fruit fly Stoichiometry: 1.0 physical association physical association false false false Table S1 2.8A R Work 0.23 R Free 0.28