DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ daleke-2012-1 mycmr Mycobacterium marinum anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Daleke MH., Ummels R., Bawono P., Heringa J., Vandenbroucke-Grauls CM., Luirink J., Bitter W. DIP original experiment: DIP-251681X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx General secretion signal for the mycobacterial type VII secretion pathway. Daleke MH., Ummels R., Bawono P., Heringa J., Vandenbroucke-Grauls CM., Luirink J., Bitter W. Only protein-protein interactions imex curation daleke-2012-2 ecolx Escherichia coli anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Daleke MH., Ummels R., Bawono P., Heringa J., Vandenbroucke-Grauls CM., Luirink J., Bitter W. DIP original experiment: DIP-251682X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx General secretion signal for the mycobacterial type VII secretion pathway. Daleke MH., Ummels R., Bawono P., Heringa J., Vandenbroucke-Grauls CM., Luirink J., Bitter W. Only protein-protein interactions imex curation ppe41_myctu PPE family protein PPE41 Rv2430c PPE41 LH57_13290 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MHFEAYPPEVNSANIYAGPGPDSMLAAARAWRSLDVEMTAVQRSFNRTLLSLMDAWAGPVVMQLMEAAKPFVRWLTDLCVQLSEVERQIHEIVRAYEWAHHDMVPLAQIYNNRAERQILIDNNALGQFTAQIADLDQEYDDFWDEDGEVMRDYRLRVSDALSKLTPWKAPPPIAHSTVLVAPVSPSTASSRTDT mint q7d756_mycto MT2506 protein protein mycto Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) MSFVITNPEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYATAEADNIKTFS D931C0DB4265B3F9 mint pe25-ppe41-4 3241835 N/A 3241837 unspecified role unspecified role prey prey mycmr Mycobacterium marinum N/A 3241838 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mycmr Mycobacterium marinum physical association physical association false false false pe25-ppe41-5 3241836 N/A 3241837 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3241838 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false