DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ gonzlez-2011-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. DIP original experiment: DIP-250541X PLoS biology 2011 IMEx Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. Only protein-protein interactions imex curation gonzlez-2011-2 human Homo sapiens Human bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret predetermined predetermined participant predetermined González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. DIP original experiment: DIP-250539X PLoS biology 2011 IMEx Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. Only protein-protein interactions imex curation gonzlez-2011-3 rat Rattus norvegicus (Rat) Rat pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. DIP original experiment: DIP-250546X PLoS biology 2011 IMEx Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. Only protein-protein interactions imex curation gonzlez-2011-4 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. DIP original experiment: DIP-250544X PLoS biology 2011 IMEx Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. Only protein-protein interactions imex curation gonzlez-2011-5 rat Rattus norvegicus (Rat) Rat pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. DIP original experiment: DIP-250545X PLoS biology 2011 IMEx Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. Only protein-protein interactions imex curation gonzlez-2011-6 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. DIP original experiment: DIP-250542X PLoS biology 2011 IMEx Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. Only protein-protein interactions imex curation gonzlez-2011-7 human Homo sapiens Human bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret predetermined predetermined participant predetermined González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. DIP original experiment: DIP-250540X PLoS biology 2011 IMEx Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. Only protein-protein interactions imex curation gonzlez-2011-8 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. DIP original experiment: DIP-250543X PLoS biology 2011 IMEx Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. Only protein-protein interactions imex curation drd4_human D(4) dopamine receptor DRD4 D(2C) dopamine receptor Dopamine D4 receptor protein protein human Homo sapiens Human MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVATERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCTASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGRDPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSGPGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPSLPQDPCGPDCAPPAPGLPPDPCGSNCAPPDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALCPACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC mint ada1b_human Alpha-1B adrenergic receptor Alpha-1B adrenoreceptor ADRA1B protein protein human Homo sapiens Human MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF ada1b_rat Alpha-1B adrenergic receptor Alpha-1B adrenoreceptor Adra1b protein protein rat Rattus norvegicus (Rat) Rat MNPDLDTGHNTSAPAHWGELKDDNFTGPNQTSSNSTLPQLDVTRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRILGCQCRGGRRRRRRRRLGACAYTYRPWTRGGSLERSQSRKDSLDDSGSCMSGTQRTLPSASPSPGYLGRGTQPPVELCAFPEWKPGALLSLPEPPGRRGRLDSGPLFTFKLLGDPESPGTEGDTSNGGCDTTTDLANGQPGFKSNMPLAPGHF drd4_rat D(4) dopamine receptor Drd4 D(2C) dopamine receptor Dopamine D4 receptor protein protein rat Rattus norvegicus (Rat) Rat MGNSSATGDGGLLAGRGPESLGTGTGLGGAGAAALVGGVLLIGMVLAGNSLVCVSVASERILQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASIFNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVAAPVVCGLNDVPGRDPTVCCLEDRDYVVYSSICSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPVSDPTQGPLFSDCPPPSPSLRTSPTVSSRPESDLSQSPCSPGCLLPDAALAQPPAPSSRRKRGAKITGRERKAMRVLPVVVGAFLMCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVNSALNPIIYTIFNAEFRSVFRKTLRLRC adrb1_rat Beta-1 adrenergic receptor Beta-1 adrenoreceptor Adrb1 Adrb1r protein protein rat Rattus norvegicus (Rat) Rat MGAGALALGASEPCNLSSAAPLPDGAATAARLLVLASPPASLLPPASEGSAPLSQQWTAGMGLLLALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVVWGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITLPFRYQSLLTRARARALVCTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLTGPPRPPSPAPSPSPGPPRPADSLANGRSSKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAACRRRAAHGDRPRASGCLARAGPPPSPGAPSDDDDDDAGATPPARLLEPWAGCNGGTTTVDSDSSLDEPGRQGFSSESKV adrb1_human Beta-1 adrenergic receptor Beta-1 adrenoreceptor ADRB1 ADRB1R B1AR protein protein human Homo sapiens Human MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAGMGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVVWGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVCTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAPLANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV drd4-adra1b-1 3241629 N/A 3241637 unspecified role unspecified role bait bait YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3241638 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false drd4-adra1b-2 3241630 N/A 3241637 unspecified role unspecified role fluorescence donor fluorescence donor Rluc-tag Rluc-tag renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3241638 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human proximity proximity close-contact colocalization neighbourhood interaction false false false adra1b-drd4-1 3241631 N/A 3241639 unspecified role unspecified role unspecified role unspecified role rat Rattus norvegicus (Rat) Rat N/A 3241640 unspecified role unspecified role unspecified role unspecified role rat Rattus norvegicus (Rat) Rat proximity proximity close-contact colocalization neighbourhood interaction false false false drd4-adra1b-3 3241632 N/A 3241639 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3241640 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association false false false adrb1-drd4-1 3241633 N/A 3241641 unspecified role unspecified role unspecified role unspecified role rat Rattus norvegicus (Rat) Rat N/A 3241640 unspecified role unspecified role unspecified role unspecified role rat Rattus norvegicus (Rat) Rat proximity proximity close-contact colocalization neighbourhood interaction false false false drd4-adrb1-1 3241634 N/A 3241637 unspecified role unspecified role bait bait YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3241642 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false drd4-adrb1-2 3241635 N/A 3241637 unspecified role unspecified role fluorescence donor fluorescence donor Rluc-tag Rluc-tag renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3241642 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human proximity proximity close-contact colocalization neighbourhood interaction false false false drd4-adrb1-3 3241636 N/A 3241641 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3241640 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association false false false