DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ fu-2012-2 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. DIP original experiment: DIP-250645X Nature 2012 IMEx NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants. Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. Only protein-protein interactions imex curation fu-2012-3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. DIP original experiment: DIP-250655X Nature 2012 IMEx NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants. Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. Only protein-protein interactions imex curation fu-2012-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. DIP original experiment: DIP-250650X Nature 2012 IMEx NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants. Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. Only protein-protein interactions imex curation fu-2012-5 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. DIP original experiment: DIP-250646X Nature 2012 IMEx NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants. Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. Only protein-protein interactions imex curation fu-2012-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. DIP original experiment: DIP-250651X Nature 2012 IMEx NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants. Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. Only protein-protein interactions imex curation fu-2012-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. DIP original experiment: DIP-250656X Nature 2012 IMEx NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants. Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. Only protein-protein interactions imex curation fu-2012-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. DIP original experiment: DIP-250647X Nature 2012 IMEx NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants. Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. Only protein-protein interactions imex curation fu-2012-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. DIP original experiment: DIP-250652X Nature 2012 IMEx NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants. Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. Only protein-protein interactions imex curation fu-2012-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. DIP original experiment: DIP-250653X Nature 2012 IMEx NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants. Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. Only protein-protein interactions imex curation fu-2012-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. DIP original experiment: DIP-250657X Nature 2012 IMEx NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants. Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. Only protein-protein interactions imex curation fu-2012-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. DIP original experiment: DIP-250648X Nature 2012 IMEx NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants. Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. Only protein-protein interactions imex curation fu-2012-13 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. DIP original experiment: DIP-250658X Nature 2012 IMEx NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants. Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. Only protein-protein interactions imex curation fu-2012-14 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. DIP original experiment: DIP-250654X Nature 2012 IMEx NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants. Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. Only protein-protein interactions imex curation fu-2012-15 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. DIP original experiment: DIP-250649X Nature 2012 IMEx NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants. Fu ZQ., Yan S., Saleh A., Wang W., Ruble J., Oka N., Mohan R., Spoel SH., Tada Y., Zheng N., Dong X. Only protein-protein interactions imex curation cul3a_arath Cullin-3A CUL3A T2P11.2 CUL3 At1g26830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNQKKRNFQIEAFKHRVVVDPKYADKTWQILERAIHQIYNQDASGLSFEELYRNAYNMVLHKFGEKLYTGFIATMTSHLKEKSKLIEAAQGGSFLEELNKKWNEHNKALEMIRDILMYMDRTYIESTKKTHVHPMGLNLWRDNVVHFTKIHTRLLNTLLDLVQKERIGEVIDRGLMRNVIKMFMDLGESVYQEDFEKPFLDASSEFYKVESQEFIESCDCGDYLKKSEKRLTEEIERVAHYLDAKSEEKITSVVEKEMIANHMQRLVHMENSGLVNMLLNDKYEDLGRMYNLFRRVTNGLVTVRDVMTSHLREMGKQLVTDPEKSKDPVEFVQRLLDERDKYDKIINTAFGNDKTFQNALNSSFEYFINLNARSPEFISLFVDDKLRKGLKGITDVDVEVILDKVMMLFRYLQEKDVFEKYYKQHLAKRLLSGKTVSDDAERSLIVKLKTECGYQFTSKLEGMFTDMKTSEDTMRGFYGSHPELSEGPTLIVQVLTTGSWPTQPAVPCNLPAEVSVLCEKFRSYYLGTHTGRRLSWQTNMGTADIKAIFGKGQKHELNVSTFQMCVLMLFNNSDRLSYKEIEQATEIPAADLKRCLQSLACVKGKNVIKKEPMSKDIGEEDLFVVNDKFTSKFYKVKIGTVVAQKETEPEKQETRQRVEEDRKPQIEAAIVRIMKSRKILDHNNIIAEVTKQLQPRFLANPTEIKKRIESLIERDFLERDSTDRKLYRYLA npr1_arath Regulatory protein NPR1 SAI1 BTB/POZ domain-containing protein NPR1 NPR1 NIM1 At1g64280 F15H21.6 Nonexpresser of PR genes 1 Non-inducible immunity protein 1 Salicylic acid insensitive 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTTIDGFADSYEISSTSFVATDNTDSSIVYLAAEQVLTGPDVSALQLLSNSFESVFDSPDDFYSDAKLVLSDGREVSFHRCVLSARSSFFKSALAAAKKEKDSNNTAAVKLELKEIAKDYEVGFDSVVTVLAYVYSSRVRPPPKGVSECADENCCHVACRPAVDFMLEVLYLAFIFKIPELITLYQRHLLDVVDKVVIEDTLVILKLANICGKACMKLLDRCKEIIVKSNVDMVSLEKSLPEELVKEIIDRRKELGLEVPKVKKHVSNVHKALDSDDIELVKLLLKEDHTNLDDACALHFAVAYCNVKTATDLLKLDLADVNHRNPRGYTVLHVAAMRKEPQLILSLLEKGASASEATLEGRTALMIAKQATMAVECNNIPEQCKHSLKGRLCVEILEQEDKREQIPRDVPPSFAVAADELKMTLLDLENRVALAQRLFPTEAQAAMEIAEMKGTCEFIVTSLEPDRLTGTKRTSPGVKIAPFRILEEHQSRLKALSKTVELGKRFFPRCSAVLDQIMNCEDLTQLACGEDDTAEKRLQKKQRYMEIQETLKKAFSEDNLELGNSSLTDSTSSTSKSTGGKRSNRKLSHRRR npr4_arath Regulatory protein NPR4 BTB/POZ domain-containing protein NPR4 T16H5.20 NPR4 At4g19660 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAATAIEPSSSISFTSSHLSNPSPVVTTYHSAANLEELSSNLEQLLTNPDCDYTDAEIIIEEEANPVSVHRCVLAARSKFFLDLFKKDKDSSEKKPKYQMKDLLPYGNVGREAFLHFLSYIYTGRLKPFPIEVSTCVDSVCAHDSCKPAIDFAVELMYASFVFQIPDLVSSFQRKLRNYVEKSLVENVLPILLVAFHCDLTQLLDQCIERVARSDLDRFCIEKELPLEVLEKIKQLRVKSVNIPEVEDKSIERTGKVLKALDSDDVELVKLLLTESDITLDQANGLHYAVAYSDPKVVTQVLDLDMADVNFRNSRGYTVLHIAAMRREPTIIIPLIQKGANASDFTFDGRSAVNICRRLTRPKDYHTKTSRKEPSKYRLCIDILEREIRRNPLVSGDTPTCSHSMPEDLQMRLLYLEKRVGLAQLFFPAEANVAMDVANVEGTSECTGLLTPPPSNDTTENLGKVDLNETPYVQTKRMLTRMKALMKTVETGRRYFPSCYEVLDKYMDQYMDEEIPDMSYPEKGTVKERRQKRMRYNELKNDVKKAYSKDKVARSCLSSSSPASSLREALENPT npr3_arath Regulatory protein NPR3 NPR3 BTB/POZ domain-containing protein NPR3 K17O22_11 At5g45110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATLTEPSSSLSFTSSHFSYGSIGSNHFSSSSASNPEVVSLTKLSSNLEQLLSNSDCDYSDAEIIVDGVPVGVHRCILAARSKFFQDLFKKEKKISKTEKPKYQLREMLPYGAVAHEAFLYFLSYIYTGRLKPFPLEVSTCVDPVCSHDCCRPAIDFVVQLMYASSVLQVPELVSSFQRRLCNFVEKTLVENVLPILMVAFNCKLTQLLDQCIERVARSDLYRFCIEKEVPPEVAEKIKQLRLISPQDEETSPKISEKLLERIGKILKALDSDDVELVKLLLTESDITLDQANGLHYSVVYSDPKVVAEILALDMGDVNYRNSRGYTVLHFAAMRREPSIIISLIDKGANASEFTSDGRSAVNILRRLTNPKDYHTKTAKGRESSKARLCIDILEREIRKNPMVLDTPMCSISMPEDLQMRLLYLEKRVGLAQLFFPTEAKVAMDIGNVEGTSEFTGLSPPSSGLTGNLSQVDLNETPHMQTQRLLTRMVALMKTVETGRRFFPYGSEVLDKYMAEYIDDDILDDFHFEKGSTHERRLKRMRYRELKDDVQKAYSKDKESKIARSCLSASSSPSSSSIRDDLHNTT npr2_arath Regulatory protein NPR2 NPR2 BTB/POZ domain-containing protein NPR2 F20B18.230 At4g26120 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATTTTTTTARFSDSYEFSNTSGNSFFAAESSLDYPTEFLTPPEVSALKLLSNCLESVFDSPETFYSDAKLVLAGGREVSFHRCILSARIPVFKSALATVKEQKSSTTVKLQLKEIARDYEVGFDSVVAVLAYVYSGRVRSPPKGASACVDDDCCHVACRSKVDFMVEVLYLSFVFQIQELVTLYERQFLEIVDKVVVEDILVIFKLDTLCGTTYKKLLDRCIEIIVKSDIELVSLEKSLPQHIFKQIIDIREALCLEPPKLERHVKNIYKALDSDDVELVKMLLLEGHTNLDEAYALHFAIAHCAVKTAYDLLELELADVNLRNPRGYTVLHVAAMRKEPKLIISLLMKGANILDTTLDGRTALVIVKRLTKADDYKTSTEDGTPSLKGGLCIEVLEHEQKLEYLSPIEASLSLPVTPEELRMRLLYYENRVALARLLFPVETETVQGIAKLEETCEFTASSLEPDHHIGEKRTSLDLNMAPFQIHEKHLSRLRALCKTVELGKRYFKRCSLDHFMDTEDLNHLASVEEDTPEKRLQKKQRYMELQETLMKTFSEDKEECGKSSTPKPTSAVRSNRKLSHRRLKVDKRDFLKRPYGNGD npr1-cul3a-3 3241191 N/A 3241205 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3241206 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false npr4-npr1-1 3241192 N/A 3241207 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3241206 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false npr3-npr3-1 3241193 N/A 3241208 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3241208 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false cul3a-npr3-1 3241194 N/A 3241207 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3241208 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3241205 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false npr3-npr4-1 3241195 N/A 3241207 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3241208 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false npr1-npr2-1 3241196 N/A 3241209 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3241206 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false npr3-npr1-1 3241197 N/A 3241206 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3241208 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false npr4-npr3-1 3241198 N/A 3241207 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3241208 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false npr4-npr4-1 3241199 N/A 3241207 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3241207 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false npr2-npr1-1 3241200 N/A 3241209 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3241206 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false npr4-npr1-2 3241201 N/A 3241207 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3241206 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false npr4-1 3241202 N/A 3241207 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false npr3-npr1-2 3241203 N/A 3241206 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3241208 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false npr1-npr4-1 3241204 N/A 3241207 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3241206 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false