DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ butcher-2012-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Butcher J., Sarvan S., Brunzelle JS., Couture JF., Stintzi A. DIP original experiment: DIP-251670X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation. Butcher J., Sarvan S., Brunzelle JS., Couture JF., Stintzi A. Only protein-protein interactions imex curation butcher-2012-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Butcher J., Sarvan S., Brunzelle JS., Couture JF., Stintzi A. DIP original experiment: DIP-251671X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation. Butcher J., Sarvan S., Brunzelle JS., Couture JF., Stintzi A. Only protein-protein interactions imex curation fur_camje Ferric uptake regulation protein fur Cj0400 protein protein camje Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168) MLIENVEYDVLLERFKKILRQGGLKYTKQREVLLKTLYHSDTHYTPESLYMEIKQAEPDLNVGIATVYRTLNLLEEAEMVTSISFGSAGKKYELANKPHHDHMICKNCGKIIEFENPIIERQQALIAKEHGFKLTGHLMQLYGVCGDCNNQKAKVKI fur-1 3241104 N/A 3241106 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false fur-2 3241105 N/A 3241106 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false