DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ herzig-2012-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Herzig S., Raemy E., Montessuit S., Veuthey JL., Zamboni N., Westermann B., Kunji ER., Martinou JC. DIP original experiment: DIP-268279X Science (New York, N.Y.) 2012 IMEx Identification and functional expression of the mitochondrial pyruvate carrier. Herzig S., Raemy E., Montessuit S., Veuthey JL., Zamboni N., Westermann B., Kunji ER., Martinou JC. Only protein-protein interactions imex curation herzig-2012-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Herzig S., Raemy E., Montessuit S., Veuthey JL., Zamboni N., Westermann B., Kunji ER., Martinou JC. DIP original experiment: DIP-268280X Science (New York, N.Y.) 2012 IMEx Identification and functional expression of the mitochondrial pyruvate carrier. Herzig S., Raemy E., Montessuit S., Veuthey JL., Zamboni N., Westermann B., Kunji ER., Martinou JC. Only protein-protein interactions imex curation mpc2_yeast Mitochondrial pyruvate carrier 2 MPC2 YHR162W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTSSVRFAFRRFWQSETGPKTVHFWAPTLKWGLVFAGFSDMKRPVEKISGAQNLSLLSTALIWTRWSFVIKPRNILLASVNSFLCLTAGYQLGRIANYRIRNGDSISQLCSYILSGADESKKEITTGR 5C1FB3A463DE24A7 mpc1_yeast Mitochondrial pyruvate carrier 1 MPC1 FMP37 Protein FMP37 YGL080W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQPVQRAAARSFLQKYINKETLKYIFTTHFWGPVSNFGIPIAAIYDLKKDPTLISGPMTFALVTYSGVFMKYALSVSPKNYLLFGCHLINETAQLAQGYRFLKYTYFTTDEEKKALDKEWKEKEKTGKQ 1FD3A5BD176C247C mpc1-mpc2-4 3240692 N/A 3240694 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3240695 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false mpc2-mpc1-2 3240693 N/A 3240694 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3240695 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false