DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ symersky-2012-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Symersky J., Pagadala V., Osowski D., Krah A., Meier T., Faraldo-Gómez JD., Mueller DM. DIP original experiment: DIP-250939X Nature structural & molecular biology 2012 IMEx Structure of the c(10) ring of the yeast mitochondrial ATP synthase in the open conformation. Symersky J., Pagadala V., Osowski D., Krah A., Meier T., Faraldo-Gómez JD., Mueller DM. Only protein-protein interactions imex curation atp9_yeast ATP synthase subunit 9, mitochondrial OLI1 ATP9 Lipid-binding protein OLI3 Oligomycin resistance protein 1 PHO2 Q0130 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLLLFGV 82B4477D6F75D758 c_ring-1 3239621 N/A 3239622 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false