DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kim-2012-41 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kim S., Sun H., Tomchick DR., Yu H., Luo X. DIP original experiment: DIP-253562X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of human Mad1 C-terminal domain reveals its involvement in kinetochore targeting. Kim S., Sun H., Tomchick DR., Yu H., Luo X. Only protein-protein interactions imex curation kim-2012-42 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim S., Sun H., Tomchick DR., Yu H., Luo X. DIP original experiment: DIP-253569X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of human Mad1 C-terminal domain reveals its involvement in kinetochore targeting. Kim S., Sun H., Tomchick DR., Yu H., Luo X. Only protein-protein interactions imex curation kim-2012-43 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip autoradiography autoradiography Kim S., Sun H., Tomchick DR., Yu H., Luo X. DIP original experiment: DIP-253566X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of human Mad1 C-terminal domain reveals its involvement in kinetochore targeting. Kim S., Sun H., Tomchick DR., Yu H., Luo X. Only protein-protein interactions imex curation kim-2012-44 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim S., Sun H., Tomchick DR., Yu H., Luo X. DIP original experiment: DIP-253571X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of human Mad1 C-terminal domain reveals its involvement in kinetochore targeting. Kim S., Sun H., Tomchick DR., Yu H., Luo X. Only protein-protein interactions imex curation kim-2012-45 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kim S., Sun H., Tomchick DR., Yu H., Luo X. DIP original experiment: DIP-253563X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of human Mad1 C-terminal domain reveals its involvement in kinetochore targeting. Kim S., Sun H., Tomchick DR., Yu H., Luo X. Only protein-protein interactions imex curation kim-2012-46 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip autoradiography autoradiography Kim S., Sun H., Tomchick DR., Yu H., Luo X. DIP original experiment: DIP-253567X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of human Mad1 C-terminal domain reveals its involvement in kinetochore targeting. Kim S., Sun H., Tomchick DR., Yu H., Luo X. Only protein-protein interactions imex curation kim-2012-47 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip autoradiography autoradiography Kim S., Sun H., Tomchick DR., Yu H., Luo X. DIP original experiment: DIP-253568X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of human Mad1 C-terminal domain reveals its involvement in kinetochore targeting. Kim S., Sun H., Tomchick DR., Yu H., Luo X. Only protein-protein interactions imex curation kim-2012-48 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip autoradiography autoradiography Kim S., Sun H., Tomchick DR., Yu H., Luo X. DIP original experiment: DIP-253565X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of human Mad1 C-terminal domain reveals its involvement in kinetochore targeting. Kim S., Sun H., Tomchick DR., Yu H., Luo X. Only protein-protein interactions imex curation kim-2012-49 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip autoradiography autoradiography Kim S., Sun H., Tomchick DR., Yu H., Luo X. DIP original experiment: DIP-253564X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of human Mad1 C-terminal domain reveals its involvement in kinetochore targeting. Kim S., Sun H., Tomchick DR., Yu H., Luo X. Only protein-protein interactions imex curation kim-2012-50 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim S., Sun H., Tomchick DR., Yu H., Luo X. DIP original experiment: DIP-253570X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of human Mad1 C-terminal domain reveals its involvement in kinetochore targeting. Kim S., Sun H., Tomchick DR., Yu H., Luo X. Only protein-protein interactions imex curation md1l1_human Mitotic spindle assembly checkpoint protein MAD1 Mitotic arrest deficient 1-like protein 1 Mitotic checkpoint MAD1 protein homolog Tax-binding protein 181 MAD1L1 MAD1 TXBP181 protein protein human Homo sapiens Human MEDLGENTMVLSTLRSLNNFISQRVEGGSGLDISTSAPGSLQMQYQQSMQLEERAEQIRSKSHLIQVEREKMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQLQEREAGAEEKMQEQLERNRQCQQNLDAASKRLREKEDSLAQAGETINALKGRISELQWSVMDQEMRVKRLESEKQELQEQLDLQHKKCQEANQKIQELQASQEARADHEQQIKDLEQKLSLQEQDAAIVKNMKSELVRLPRLERELKQLREESAHLREMRETNGLLQEELEGLQRKLGRQEKMQETLVGLELENERLLAKLQSWERLDQTMGLSIRTPEDLSRFVVELQQRELALKDKNSAVTSSARGLEKARQQLQEELRQVSGQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDSELTPAEYSPQLTRRMREAEDMVQKVHSHSAEMEAQLSQALEELGGQKQRADMLEMELKMLKSQSSSAEQSFLFSREEADTLRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA md2l1_human Mitotic spindle assembly checkpoint protein MAD2A MAD2L1 MAD2 Mitotic arrest deficient 2-like protein 1 protein protein human Homo sapiens Human MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND mad1l1-1 3239368 N/A 3239378 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 597-718 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mad1l1-mad1l1-2 3239369 N/A 3239379 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3239378 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3239378 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-596 Region 1-596 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false mad1l1-mad1l1-3 3239370 N/A 3239378 unspecified role unspecified role prey prey C-terminal domain Region 597-718 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9Y6D9:p.Phe682Ala F682A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3239378 unspecified role unspecified role bait bait C-terminal domain Region 597-718 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9Y6D9:p.Phe682Ala F682A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false mad1l1-mad1l1-4 3239371 N/A 3239378 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3239378 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9Y6D9:p.Lys541_Met545delinsAlaAlaAlaAlaAla K541A/V542A/H543A/L544A/M545A mutation mutation certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false mad1l1-4 3239372 N/A 3239378 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 597-718 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mad1l1-mad1l1-5 3239373 N/A 3239378 unspecified role unspecified role prey prey C-terminal domain Region 597-718 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9Y6D9:p.Leu709Ala L709A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3239378 unspecified role unspecified role bait bait C-terminal domain Region 597-718 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9Y6D9:p.Leu709Ala L709A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false mad1l1-mad1l1-6 3239374 N/A 3239378 unspecified role unspecified role prey prey C-terminal domain Region 597-718 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9Y6D9:p.Phe629Ala F629A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3239378 unspecified role unspecified role bait bait C-terminal domain Region 597-718 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9Y6D9:p.Phe629Ala F629A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false mad1l1-mad1l1-7 3239375 N/A 3239378 unspecified role unspecified role prey prey C-terminal domain Region 597-718 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9Y6D9:p.Leu677Ala L677A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3239378 unspecified role unspecified role bait bait C-terminal domain Region 597-718 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9Y6D9:p.Leu677Ala L677A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false mad1l1-mad1l1-8 3239376 N/A 3239378 unspecified role unspecified role prey prey C-terminal domain Region 597-718 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9Y6D9:p.Tyr655Ala Y655A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3239378 unspecified role unspecified role bait bait C-terminal domain Region 597-718 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9Y6D9:p.Tyr655Ala Y655A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false mad1l1-mad2l1-10 3239377 N/A 3239379 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3239378 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9Y6D9:p.Lys541_Met545delinsAlaAlaAlaAlaAla K541A/V542A/H543A/L544A/M545A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false