DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mu-2012-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. DIP original experiment: DIP-250389X Structure (London, England : 1993) 2012 IMEx Two distinct binding modes define the interaction of Brox with the C-terminal tails of CHMP5 and CHMP4B. Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. Only protein-protein interactions imex curation mu-2012-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. DIP original experiment: DIP-250382X Structure (London, England : 1993) 2012 IMEx Two distinct binding modes define the interaction of Brox with the C-terminal tails of CHMP5 and CHMP4B. Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. Only protein-protein interactions imex curation mu-2012-3 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. DIP original experiment: DIP-250386X Structure (London, England : 1993) 2012 IMEx Two distinct binding modes define the interaction of Brox with the C-terminal tails of CHMP5 and CHMP4B. Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. Only protein-protein interactions imex curation mu-2012-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. DIP original experiment: DIP-250390X Structure (London, England : 1993) 2012 IMEx Two distinct binding modes define the interaction of Brox with the C-terminal tails of CHMP5 and CHMP4B. Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. Only protein-protein interactions imex curation mu-2012-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. DIP original experiment: DIP-250383X Structure (London, England : 1993) 2012 IMEx Two distinct binding modes define the interaction of Brox with the C-terminal tails of CHMP5 and CHMP4B. Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. Only protein-protein interactions imex curation mu-2012-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. DIP original experiment: DIP-250393X Structure (London, England : 1993) 2012 IMEx Two distinct binding modes define the interaction of Brox with the C-terminal tails of CHMP5 and CHMP4B. Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. Only protein-protein interactions imex curation mu-2012-7 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. DIP original experiment: DIP-250387X Structure (London, England : 1993) 2012 IMEx Two distinct binding modes define the interaction of Brox with the C-terminal tails of CHMP5 and CHMP4B. Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. Only protein-protein interactions imex curation mu-2012-8 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. DIP original experiment: DIP-250391X Structure (London, England : 1993) 2012 IMEx Two distinct binding modes define the interaction of Brox with the C-terminal tails of CHMP5 and CHMP4B. Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. Only protein-protein interactions imex curation mu-2012-9 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. DIP original experiment: DIP-250384X Structure (London, England : 1993) 2012 IMEx Two distinct binding modes define the interaction of Brox with the C-terminal tails of CHMP5 and CHMP4B. Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. Only protein-protein interactions imex curation mu-2012-10 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. DIP original experiment: DIP-250394X Structure (London, England : 1993) 2012 IMEx Two distinct binding modes define the interaction of Brox with the C-terminal tails of CHMP5 and CHMP4B. Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. Only protein-protein interactions imex curation mu-2012-11 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. DIP original experiment: DIP-250392X Structure (London, England : 1993) 2012 IMEx Two distinct binding modes define the interaction of Brox with the C-terminal tails of CHMP5 and CHMP4B. Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. Only protein-protein interactions imex curation mu-2012-12 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. DIP original experiment: DIP-250395X Structure (London, England : 1993) 2012 IMEx Two distinct binding modes define the interaction of Brox with the C-terminal tails of CHMP5 and CHMP4B. Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. Only protein-protein interactions imex curation mu-2012-13 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. DIP original experiment: DIP-250388X Structure (London, England : 1993) 2012 IMEx Two distinct binding modes define the interaction of Brox with the C-terminal tails of CHMP5 and CHMP4B. Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. Only protein-protein interactions imex curation mu-2012-14 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. DIP original experiment: DIP-250385X Structure (London, England : 1993) 2012 IMEx Two distinct binding modes define the interaction of Brox with the C-terminal tails of CHMP5 and CHMP4B. Mu R., Dussupt V., Jiang J., Sette P., Rudd V., Chuenchor W., Bello NF., Bouamr F., Xiao TS. Only protein-protein interactions imex curation q9nzz3-1 Charged multivesicular body protein 5 CHMP5 C9orf83 SNF7DC2 Chromatin-modifying protein 5 SNF7 domain-containing protein 2 Vacuolar protein sorting-associated protein 60 CGI-34 HSPC177 PNAS-114 PNAS-2 protein protein human Homo sapiens Human MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS brox_human BRO1 domain-containing protein BROX BROX BROFTI C1orf58 BRO1 domain- and CAAX motif-containing protein protein protein human Homo sapiens Human MTHWFHRNPLKATAPVSFNYYGVVTGPSASKICNDLRSSRARLLELFTDLSCNPEMMKNAADSYFSLLQGFINSLDESTQESKLRYIQNFKWTDTLQGQVPSAQQDAVFELISMGFNVALWYTKYASRLAGKENITEDEAKEVHRSLKIAAGIFKHLKESHLPKLITPAEKGRDLESRLIEAYVIQCQAEAQEVTIARAIELKHAPGLIAALAYETANFYQKADHTLSSLEPAYSAKWRKYLHLKMCFYTAYAYCYHGETLLASDKCGEAIRSLQEAEKLYAKAEALCKEYGETKGPGPTVKPSGHLFFRKLGNLVKNTLEKCQRENGFIYFQKIPTEAPQLELKANYGLVEPIPFEFPPTSVQWTPETLAAFDLTKRPKDDSTKPKPEEEVKPVKEPDIKPQKDTGCYIS chm4b_human Charged multivesicular body protein 4b Chromatin-modifying protein 4b Vacuolar protein sorting-associated protein 32-2 SNF7-2 SNF7 homolog associated with Alix 1 CHMP4B C20orf178 SHAX1 protein protein human Homo sapiens Human MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAHDNMDIDKVDELMQDIADQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSM chm4a_human Charged multivesicular body protein 4a Chromatin-modifying protein 4a Vacuolar protein sorting-associated protein 32-1 SNF7-1 SNF7 homolog associated with Alix-2 CHMP4A C14orf123 SHAX2 CDA04 HSPC134 protein protein human Homo sapiens Human MSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS pdc6i_human Programmed cell death 6-interacting protein PDCD6IP AIP1 KIAA1375 ALIX ALG-2-interacting protein 1 Hp95 ALG-2-interacting protein X protein protein human Homo sapiens Human MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPSATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQSYYPQQ chm4c_human Charged multivesicular body protein 4c CHMP4C SHAX3 Chromatin-modifying protein 4c Vacuolar protein sorting-associated protein 32-3 SNF7-3 SNF7 homolog associated with Alix 3 protein protein human Homo sapiens Human MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT brox-chmp5-1 3239157 N/A 3239171 unspecified role unspecified role unspecified role unspecified role Region 200-219 Region 200-219 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3239172 unspecified role unspecified role unspecified role unspecified role Region 2-377 Region 2-377 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false brox-chmp5-2 3239158 N/A 3239171 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Region 200-219 Region 200-219 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q9NZZ3-1:p.Leu213Ala L213A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9NZZ3-1:p.Phe211Ala F211A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9NZZ3-1:p.Pro214Gly P214G mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3239172 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false brox-chmp5-3 3239159 N/A 3239171 unspecified role unspecified role unspecified role unspecified role Region 200-219 Region 200-219 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Fluorescein-label Fluorescein-label fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3239172 unspecified role unspecified role unspecified role unspecified role Region 2-411 Region 2-411 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q5VW32:p.[Leu208Asp;Leu212Asp] L208D/L212D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q5VW32:p.His204Ala H204A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q5VW32:p.Tyr348Ala Y348A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false brox-chmp4b-1 3239160 N/A 3239173 unspecified role unspecified role unspecified role unspecified role Region 121-224 Region 121-224 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3239172 unspecified role unspecified role unspecified role unspecified role Region 2-377 Region 2-377 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false brox-chmp4a-1 3239161 N/A 3239174 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3239172 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false brox-chmp4b-2 3239162 N/A 3239173 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9H444:p.Leu217Ala L217A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9H444:p.Trp220Ala W220A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3239172 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false brox-chmp4b-3 3239163 N/A 3239173 unspecified role unspecified role unspecified role unspecified role Region 205-224 Region 205-224 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Fluorescein-label Fluorescein-label fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3239172 unspecified role unspecified role unspecified role unspecified role Region 2-411 Region 2-411 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q5VW32:p.[Leu208Asp;Leu212Asp] L208D/L212D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false chmp4b-pdcd6ip-6 3239164 N/A 3239175 unspecified role unspecified role unspecified role unspecified role Region 1-367 Region 1-367 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3239173 unspecified role unspecified role unspecified role unspecified role Region 205-224 Region 205-224 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Fluorescein-label Fluorescein-label fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false brox-chmp4b-4 3239165 N/A 3239173 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3239172 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q5VW32:p.[Leu208Asp;Leu212Asp] L208D/L212D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false brox-chmp5-4 3239166 N/A 3239171 unspecified role unspecified role unspecified role unspecified role Region 200-219 Region 200-219 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Fluorescein-label Fluorescein-label fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9NZZ3-1:p.Phe211Ala F211A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9NZZ3-1:p.Leu213Ala L213A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9NZZ3-1:p.Pro214Gly P214G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3239172 unspecified role unspecified role unspecified role unspecified role Region 2-411 Region 2-411 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false brox-chmp5-5 3239167 N/A 3239171 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3239172 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q5VW32:p.His204Ala H204A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q5VW32:p.Tyr348Ala Y348A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q5VW32:p.[Leu208Asp;Leu212Asp] L208D/L212D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false brox-chmp4b-5 3239168 N/A 3239173 unspecified role unspecified role unspecified role unspecified role Region 205-224 Region 205-224 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Fluorescein-label Fluorescein-label fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9H444:p.Leu217Ala L217A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9H444:p.Trp220Ala W220A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3239172 unspecified role unspecified role unspecified role unspecified role Region 2-411 Region 2-411 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false brox-chmp5-6 3239169 N/A 3239171 unspecified role unspecified role unspecified role unspecified role Region 151-219 Region 151-219 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3239172 unspecified role unspecified role unspecified role unspecified role Region 2-377 Region 2-377 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false brox-chmp4c-1 3239170 N/A 3239176 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3239172 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false