DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ putcha-2012-1 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Putcha BD., Wright E., Brunzelle JS., Fernandez EJ. DIP original experiment: DIP-251627X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structural basis for negative cooperativity within agonist-bound TR:RXR heterodimers. Putcha BD., Wright E., Brunzelle JS., Fernandez EJ. Only protein-protein interactions imex curation putcha-2012-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Putcha BD., Wright E., Brunzelle JS., Fernandez EJ. DIP original experiment: DIP-251629X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structural basis for negative cooperativity within agonist-bound TR:RXR heterodimers. Putcha BD., Wright E., Brunzelle JS., Fernandez EJ. Only protein-protein interactions imex curation putcha-2012-3 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Putcha BD., Wright E., Brunzelle JS., Fernandez EJ. DIP original experiment: DIP-251628X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structural basis for negative cooperativity within agonist-bound TR:RXR heterodimers. Putcha BD., Wright E., Brunzelle JS., Fernandez EJ. Only protein-protein interactions imex curation putcha-2012-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Putcha BD., Wright E., Brunzelle JS., Fernandez EJ. DIP original experiment: DIP-251630X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structural basis for negative cooperativity within agonist-bound TR:RXR heterodimers. Putcha BD., Wright E., Brunzelle JS., Fernandez EJ. Only protein-protein interactions imex curation rxra_human Retinoic acid receptor RXR-alpha RXRA NR2B1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein human Homo sapiens Human MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT tha_chick Thyroid hormone receptor alpha THRA Nuclear receptor subfamily 1 group A member 1 NR1A1 protein protein chick Gallus gallus (Chicken) Chicken MEQKPSTLDPLSEPEDTRWLDGKRKRKSSQCLVKSSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDGCCVIDKITRNQCQLCRFKKCISVGMAMDLVLDDSKRVAKRKLIEENRERRRKEEMIKSLQHRPSPSAEEWELIHVVTEAHRSTNAQGSHWKQKRKFLPEDIGQSPMASMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLSGEMAVKREQLKNGGLGVVSDAIFDLGKSLSAFNLDDTEVALLQAVLLMSSDRTGLICVDKIEKCQETYLLAFEHYINYRKHNIPHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFEDQEV thra-rxra-1 3238759 N/A 3238763 unspecified role unspecified role prey prey Region 225-462 Region 225-462 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3238764 unspecified role unspecified role bait bait Region 148-408 Region 148-408 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false rxra-thra-1 3238760 N/A 3238763 unspecified role unspecified role unspecified role unspecified role Region 225-462 Region 225-462 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3238764 unspecified role unspecified role unspecified role unspecified role Region 148-408 Region 148-408 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rxra-thra-2 3238761 N/A 3238763 unspecified role unspecified role unspecified role unspecified role Region 225-462 Region 225-462 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3238764 unspecified role unspecified role unspecified role unspecified role Region 148-408 Region 148-408 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rxra-thra-3 3238762 N/A 3238763 unspecified role unspecified role unspecified role unspecified role Region 225-462 Region 225-462 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3238764 unspecified role unspecified role unspecified role unspecified role Region 148-408 Region 148-408 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false