DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hayashi-2012-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251625X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation hayashi-2012-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251610X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation hayashi-2012-3 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251619X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation hayashi-2012-4 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251616X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation hayashi-2012-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251624X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation hayashi-2012-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251611X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation hayashi-2012-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251626X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation hayashi-2012-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251621X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation hayashi-2012-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251620X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation hayashi-2012-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251612X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation hayashi-2012-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251622X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation hayashi-2012-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251613X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation hayashi-2012-13 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251617X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation hayashi-2012-14 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251618X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation hayashi-2012-15 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251614X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation hayashi-2012-16 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251615X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation hayashi-2012-17 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. DIP original experiment: DIP-251623X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Heterochromatin protein 1 homologue Swi6 acts in concert with Ers1 to regulate RNAi-directed heterochromatin assembly. Hayashi A., Ishida M., Kawaguchi R., Urano T., Murakami Y., Nakayama J. Only protein-protein interactions imex curation swi6_schpo Chromatin-associated protein swi6 swi6 SPAC664.01c SPAC824.10c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MKKGGVRSYRRSSTSKRSVIDDDSEPELPSMTKEAIASHKADSGSSDNEVESDHESKSSSKKLKENAKEEEGGEEEEEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEPSKRKRTARPKKPEAKEPSPKSRKTDEDKHDKDSNEKIEDVNEKTIKFADKSQEEFNENGPPSGQPNGHIESDNESKSPSQKESNESEDIQIAETPSNVTPKKKPSPEVPKLPDNRELTVKQVENYDSWEDLVSSIDTIERKDDGTLEIYLTWKNGAISHHPSTITNKKCPQKMLQFYESHLTFRENE F505CC8AC5E75EAB cid12_schpo Poly(A) RNA polymerase cid12 cid12 Caffeine-induced death protein 12 Polynucleotide adenylyltransferase cid12 SPCC663.12 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MGKVLLELHSVPWNEEGLSDNARLYSFLEFVSPKIEELKYRKLLLEKLQTHIREVVLDAELQVYGSMYIGTTLSISDVDVSLKSPRVGELEKRRVTMVLRKYLDADADFHSSARVPRINLVDVSGIGVDLTFGNDKACRTAELQKAYNEEHPIFGRLLMLLKHWLFERDLENVHHGGIASCALSYMLIGWLEMRFHKKGIDSEVQPIRALLQKFFYFWGVEWTYELFVLRPLTGQIVPKLQKGWLNEVQPNLLSIEDPIDRNNDIGKQSFQISMIKAAFVASANELLSDKTWFSTFAITEDEMFLCKQFENVINTKRSLVEGYDSDTESDELQAGG BF56B701691F8737 ers1_schpo RNA-silencing factor ers1 ers1 SPCC1393.05 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MGKVSANNQSGFFKFYIDTALLLNAEFISSFTNCINSEYNGKVKISYSSSSQQFKVIVYEEHKREAFSLFEEIVQKLKRESTVYKKPRLDIHPFGQLHYDFTTLLNFQRYLDLGYGIEDVKIKENEDIVKSKVGKKPTSSDFYIPCLIKPKIITPFEWEGNFKQVIYSPTVYNGSFKRLFYLPDNNDLLKEFAHATNTKYKASLKDNKIVVLANNDQDINAMLEKMKHIENLVSQKVYEYPEETLVYAGKIAPCQLKFLKLKFENEILYTAMHTTSIFKSVFNILGSFYTMRLLRNKHDGDSYELVPVFAKNPSKTPPCNDNFKIFSDDIKLIGCKIFAGVSLNFSSPKPAHRFYELNKTSSNLSIPVLQKPSNFHSSSTELSDNSIHQGRRAVDPVVNQNNPSNFEEMIMNKLNKLPTIDKQILGTSSLTHFQDKTTAIEHSINKSNSKQPPRFKFQLPPRPTSNTLPLEPEEELVTRYSVSSDGNTVDEAITKQSQTFQLVNSNEFNEVNANDVHKSLRQNCAKLDFDDSKSKNLLSVECLELDKGSDCSTPKSGSLTPSIDMKFLRLQDEKMDDLGDNYYTILMSSNPVSSYGVGSLYLFQPKIVCSEKYINHEEIDNMNLKSLHRWLSRSLHVLQSFSGEIELNLEFGVILYPNISSDVSACSHGFMNIYKDLNLPRSYFADCITKSVSNIDSLLNTPVKILFGRTEYTYPLIEHEVLDSKNYFVFKGSLLFTDDKRNKTEDSTVFFSMICSSKLDQFAFYKDSKQSSTCTINFPLALWDSRLRIETKVPLNDAILTEFSKSIRFRNVNKDLLLVFGNMEDRVIIHSVTRINENSVPFNKNLLPHSLEFILKCSKVKSYDISPSSINSKEAFVCLDRSKESKPIESCFSLSIQSVYMQSQFKYNNSIRAGETAPWKLANKQFIGGAITENVSDLYTAAIIMVNQLGGIHPTI C489636820E19512 tas3_schpo RNA-induced transcriptional silencing complex protein tas3 SPBC83.03c tas3 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEKGIKKYLPSLPFLACISDFPENHGTSRRSATVSLERVHELFTEHWLSNLKNRREKRQELAEEAVYCRSEMLSQRKLLAAVDFPQQLKNSPAKAKATHTSSGVTKEVRASKKYTSSNVEFPLVTDGKEKPVKSKQLRKNSVTEFEKPIETKKSKHRKSRNKFLDKSSGSMEIESWDNSTSDSIIESSSRLHESISLRENDIRSSDSKSVGWDDNSTGFRESSKSLDHTDTSMFMELDSNSDPQFRPKYQAKSSWFAPDDPEASWGNLDDGWGETNGSWSSTDDTKHYKNEWAESINLDNFNRPSQQEDYDKPKNTQVSRSSNHHRRYDSYHPDSRSDSYRSKREHYDNRDTGPRSKHLEKSSYVYNQNFEDRTHLSDHGAHFHLGNANDFNMQGSSRKRKASDRQRESRENELPTKKLNASDSHNPLASLTTDKNDLYINWLKSLSFFQTNSSCAEALVKVIPHYHNKLIDFSQVLQLVFSASEKFPIQENQPLPEQLMFLSNLEKQTPFAKAVGSSIYKLVTGKNLSLDFASQILKEASILEHKNEK 4569CF59851A22A0 hrr1_schpo Helicase required for RNAi-mediated heterochromatin assembly 1 hrr1 SPCC1739.03 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEQVQDEIWKLSTLDAWEMVNKNTEVVFDEIPEPETLSEMKRHPLYSNIFNADNNTTSFTEQIETSETSKTQDSEGNKVDKNLKENKSIRRKRSIDNDYELSNVKRNDITSGKNREFENEHHPASDTSSWRELPSIPTLEELTSKSVELPSNNIYGGYKSFEDYLSIHYRLLREDAVSPLRESVLRYKVNPNYITGSSLAVYDHVRIDGYTISSSVIAAKLSFSVRAKKKIKWATSRRLISGSLVLLSNDDFQTFRIGTVCARPLSGLNKHPHEIDVKFEDISISLDPREEYVMIEATSGYWEAYKHVLRSLQRLSASTFPMKDYLVHCKSNQETAKHIQNNPRIRINSILKNNSQKIVNALEPFGPGEYILDSSQLKAYQSMLTKRLSIIQGPPGTGKSFVTLKAIETLLENTHSHVLPILVACQTNHAVDQILIRLLHQGASVMRLGSRTKDPEIAAVTIFQKAKHTKHSFKAAYNEIRHKKQRLIKQITNIMHNFNLEFVTLSYLHSKGIITTSQLESLRNNTEWISSVAENGEKTEEELISIWLGDAKVELITPSEITDGFEEELQIDPEKLEEIQKEAEDSGALMEEELRGKFINLRCKYLFSKLTTLHEKEIDTLLTIPNIWDIPEYSRGIIYCRWLESAYAAAEKELNRLYRFYLKVDRERIGFSNKRAAILLRGANVIGMTTTGLNKYRDILERINPKICFIEEAADVLEGPIIPAVFPSLEQLVLIGDHKQLRPGCSTYALRQDPFNLSISMFERLVENDMEYTRLTMQRRMHPQIRRLVSSVYEDLSDYEITKYWPSIPGMGEIRRFFLTHSRIEDNDGFASKINLFEAQMLVQFAVYLINNGVEPQKITCLTFYAAQKDLIERLLSESLNREKHFIKVATVDGYQGEENDVVLLSLVRNNDRTEVGFLSSPHRVCVSLSRARRGLFIFGNAQLVAESNPLWWDAINTLMNDETIQGLGDHLPLFTKDGTIYVNDPVELLDVNMRLTRK 8CBE21AF974D56CC clr4_schpo Histone-lysine N-methyltransferase, H3 lysine-9 specific clr4 SPBC428.08c kmt1 Histone H3-K9 methyltransferase Cryptic loci regulator 4 Lysine N-methyltransferase 1 Protein lysine methyltransferase clr4 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSPKQEEYEVERIVDEKLDRNGAVKLYRIRWLNYSSRSDTWEPPENLSGCSAVLAEWKRRKRRLKGSNSDSDSPHHASNPHPNSRQKHQHQTSKSVPRSQRFSRELNVKKENKKVFSSQTTKRQSRKQSTALTTNDTSIILDDSLHTNSKKLGKTRNEVKEESQKRELVSNSIKEATSPKTSSILTKPRNPSKLDSYTHLSFYEKRELFRKKLREIEGPEVTLVNEVDDEPCPSLDFQFISQYRLTQGVIPPDPNFQSGCNCSSLGGCDLNNPSRCECLDDLDEPTHFAYDAQGRVRADTGAVIYECNSFCSCSMECPNRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGEVITSAEAAKRDKNYDDDGITYLFDLDMFDDASEYTVDAQNYGDVSRFFNHSCSPNIAIYSAVRNHGFRTIYDLAFFAIKDIQPLEELTFDYAGAKDFSPVQSQKSQQNRISKLRRQCKCGSANCRGWLFG 53C3EC87BCBA51FF t111_schpo Putative transcription initiation factor TFIID 111 kDa subunit SPAC2G11.14 TAFII-111 TBP-associated factor 111 kDa protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSFDGLIVENENTKSGYNDGNDLTDLFKQNGTDMSVINSLLGDTNNPGMNESPKILDSSFENSNPQDGPNYEDFDFMGSIHKEFGNNINEMDDMEDVSDDNLPEEEQAVNYTGDKDDEDFGKLLAKEMGEEAAGQVLSGVGFSIPSGLVPPSEPSKTVSSTTEELQNEAQIRESIVKTFFPTFERGVLLNFSELFKPKPVKLAPPKKKTPKVCVPGRLTLEVDTDYAIIFNSKKSLPLKRNVVSPISTHTKKRRRTANTSQRNDGLDLNTVFTTNDWEKNIIYDESDVNKTNQSSFFIDKSLVDIDFAFDENIFDGDTGTSKVVLNLNDPKLLLQPQLPKKEDSQRSFADTHQRNSLAWKFNISNDPAYEMLKQNHQSKVRNTLSQLAIEHAAFAEKLTFPYYKTRLSKRAVRSYHRPTMSFKPNAAIVFSPLIVRKRSKDKHKSERELIPTTKEITMGDTTHAILVEFSEEHPAVLSNAGMASRIVNYYRKKNEQDESRPKLEVGESHVLDVQDRSPFWNFGSVEPGEITPTLYNKMIRAPLFKHEVPPTDFILIRNSSSYGSKYYLKNINHMFVSGQTFPVTDVPGPHSRKVTTASKNRLKMLVFRLIRRSPNGGLFIRQLSKHFSDQNEMQIRQRLKEFMEYKKKGDGPGYWKLKSNEVVPDEAGTRSMVSPETVCLLESMQVGVRQLEDAGYGKTMDEINDDEDEEQPAEQLLAPWITTRNFINATQGKAMLTLFGEGDPTGIGEGYSFIRTSMKGGFKPAGETADDKPEPQTKNAHAYNVAKQQRAYEEEINRIWNAQKRGLSINNLEELAKKYGINSIHDDYVESNEETTREETPSSDKVLRIVRLYRDKNGNLERKQETIHDPIVIHAYLKKRREIDEQSTALDAVVPTGDEAIDRRNRRRLEQELAKSQKNWERRRARHAAKEGINLNGEGRKPTTRKCSNCGQVGHMKTNKICPLFGRPEGGLATMLDKN 37873DCC23884701 rik1_schpo Chromatin modification-related protein rik1 rik1 SPCC11E10.08 Silencing protein rik1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MALCVHSFWATAVDTATSCHFISSENCLVLLQALKINIYLCSEVHGLQFFTSIPLFSTVKHIRPYRPPGLDRDYLFVVLNDDTYFSIYWDEDYQKVIVDHPPVRYRVTFPWNRNAKSYCLVDLRMRAIFLSIDEISMICIRILSAEERLKTGRSIDSGFPFSFPVHLIYDMCILNDSSTPTLVVLHSDGLDCYVTAFLLDLSSKSLGKGIRLFERVKPSMIMPFGKRGLLVFESLFIHCMYRGNFVTINGPCTTYMHWTPLKGQKMHYIVCDTNGYLFGVYSSILGKNKWSLVMERLPIPPFDFITSLNSIHEGLLFIGSKNSESKLINLSTLKDVDSIPNLGPIHDLLVLKNDIEKSFLVCAGTPRNASLIYFQHALKLDILGQTKISGILRAMVLPSYPEHKLFLGFPSETVAFNIKEDFQLELDPSLSTKERTIALSGTNGEFVQVTSTFLCIYDSAKRSRLVYIEKITNAACYQEYSAIVINGTALAIFKKDTEVARKVFESEISCLDFSAQFQIGVGFWSKQVMILTFSDNSSISCAFQTNVPSLPRNIILEGVGVDRNLLLVSSGSGEFKSYVLFKNNLVFSETKHFGTTPVSFRRFTMNIGTYIICNNDCPHMVYGFNGALCYMPLSMPQSYDVCQFRDNSGKDFLISVSLGGLKFLQLNPLPELTPRKVLLEHVPLQAIIFQNKLLLRTLENRYEDYESYKENYHLELVDSYDDNSFRVFSFTENERCEKVLKINESSLLVGTSIIEQDKLVPVNGRLILLEFEKELQSLKVVSSMVLSAAVIDLGVYNDRYIVAFGQQVAIVKLTEERLMIDSRISLGSIVLQLIVEGNEIAIADSIGRFTIMYFDGQKFIVVARYLFGENIVKAALYEGTVYIIATNSGLLKLLRYNKDAKNFNDRFICESVYHLHDKVSKFQNFPITNTNSFLEPKMLFATEIGAIGSIVSLKDKELELEELTRKIRKLKFSYLSSMDYESIEADLISPVPFIDGDLVIDVKRWASSELFRLCRSVEHRESLNSYQKVQALLEEIQSLC 0C76BB59E1215BF1 chp1_schpo Chromo domain-containing protein 1 chp1 SPAC18G6.02c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MVSVKPLPDIDSNEGETDADVYEVEDILADRVNKNGINEYYIKWAGYDWYDNTWEPEQNLFGAEKVLKKWKKRKKLIAKGLLEPFDAEDNEAKKMKREKEILRQQRQKRKSELTQLSQKVKEKFKKMRKKPARRIVTIANDEEEEDDQTMDEDAFERKSMQGELKERNLTDKTSTLSTSFGETSPDVNPFYLSEWPTVTDSILLSKSLSSDAIPLKNGEIKSTMLMPSDSDNSVPGIQNSNNLENTGAFVENANSPQSNTPLSTFRHSSPLSLSPVITSDNDVANSLFFSNSTPLPSSLKIKKEAPKLETHTILVSDNSGSLTKQDILSYFAFIKGNIEVFFLKSPKKDKVCNMAYIQFDSIEQAKLAYDKGHPSWHVTLVKGKISTDMEECKVSKSILKTTPSKKANARSVSFTQTTTDTLSESEKFASNVDLDENFDFNVNVTNEDAKQLKKSVIGSSWTTVNNDWNSVSKSDQTFENDGASKVVPAGNITLNSDNSLHHSISESEDLSSASTLSDYFRFVLRVGKSLYYAGELSFDISKLKAETEHQQLLRSLVSCKQVDVLRFVTSQYLEVFGTCLTKVLSGSLCIRSDVDMTHFKNILNRGNGAGIVLGSNYTLLLFTEDNNALMNLYDCQGQSNSPFWMVIFEPLESILVEWSAKNLRPKKPYHKSQSYLSYLLQLGHIDLHKIGAFQATQILIVSKQPSPEAEELEDTFREAAIPTFRGLEIPESLFLSQNVFVFLNVSLEDDFDQLQFLTLAKRKSCKFFLFGLSLPLKSPNDSHVGTDFKKNNEPLDKLTYSQYLRPMFPKGGVVSVTLSALIKTPRLLELISPFLEIKKDSWILILPPSIVDMVKSYFVTNNPDKSLLEIQNLLNTLQRYLTNPALKNVTLYQDWDIVIDDSADVSLASTLQLYQKKNYDKYRRFVLIHELKNELTPVNGLDIVDYDEFKETFMRAIGLK E92C16BBD0D5957C rdp1_schpo RNA-dependent RNA polymerase 1 rdp1 csp7 rdr1 SPAC6F12.09 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAVSLNDFISVKLKRYSRESPWERLRVPYRNKKQKKWASVHNNEAQLHSANKRNDNCLIQRSSTWRLGDMITLVIKDIPVTWLSNEGGKLYNLWEPLHDYGTIEFMKINEPLNGQTSTTAIVQFAPPPKVPFWEPNGKINVKGVDLAVQIDITAHRSHISRQVFSKNSFRSDQLVKIPLSSFKLGQVYDERIVPLFGVDCGITVTESNLLVYFNFKKLCVLFDASFDKQIETFRLDFDFHSIIGDVGTDYYDDHISLVFRFRFSPLIFRKSKNATESRVQTFWTASHLWRRHYDILPFNVSPTTASPIELLNCHNAPIGRCNVLVLSFSIRDESDKDDIAFLLHNLEKFNLKSQLDKVVFHLVPDYKHRCSLINDKEIEEEIAYLLQACLSKNLLSEIDLPIILANLKKLSKERAKKFLRLILTSKTALINPSELDFTKSFVFYDLSSASSIHIKKLYVTPTTLRIVEDSLEAGNRVIRNFKDFANRFMRVQITDEYYKQKIRGGSDGFRNEKLYSRIQQLLTYGIKVGNQIYEFLAFGNSQLREHGAYFFASGSDLNAKQIREWMGDFSEINSVSKYAARMGQCFSTTKEINRFCVDISLQDDIVRNNHCFTDGVGMASLSVIRRLSLEVKNHDMFPSAFQFRMGGYKGVLSLAPPTKLEYHQGNLVFPRRSQDKFKSFHSTLEVIKISRFSNAHLNMQLITLLEGLGVEKTVFLELTRSQLSKMNESINSKQKSILMLRDNVDEYHSTLIIADFIQAGFLERDDAFTENLLNLYYEWVLRLIKEKQKVSVPKGAYLLGVADETGTLKGHYDDAVLSVPEIFIQITDTSTSFGSYSTGKLKTRVIVGLCIVARNPSLHPGDVRVCKAVRCDELMHLKNVIVFPTTGDRSIPAMCSGGDLDGDEYTVIWDQRLLPKIVNYPPLLESSPKKSIDFLEGKPLIDSVKEFFVNYIKYDSLGLISNAWKAWAHDHDNNPEGIFGNVCLELAEMHSKAVDFAKSGVACKMQAKYHPKRYPDFMQKTKTRSFRSETAVGKIFRYAARFQRESGRPATYNPIMNTVYDPCMKLPRFKTEYLNVAEEVKKHYDNDLRSIMARFDISTEYEVYTAFILFKDDLAKTVNEYGLREEVSFQFDLLKKKYTQEYLEKCALSNQSAFDSSEYEERINSAVAATYDVTYDQRVKSVGNGTTEVLISFPYLFSSRLCQLSRKAMLTANNF 389B95C8217CB05C rl32a_schpo 60S ribosomal protein L32-A rpl3202 rpl32a SPAC3H5.10 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAAVNIIKKRTKPFKRHQSDRFKRVGESWRKPRGIDSCVRRRFRGTISMPKIGYGNNKKTRYCMPNGLKAFLVRNVSDVELLLMHNKTYAAEIAGNVSARKRVEIVEKARALGVKVTNAGAKVRSQE 4BBB3CEB2E359E05 mint ago1_schpo Protein argonaute Eukaryotic translation initiation factor 2C 2-like protein ago1 PAZ Piwi domain protein ago1 Cell cycle control protein ago1 RNA interference pathway protein ago1 ago1 csp9 SPCC736.11 Protein slicer protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSYKPSSEIALRPGYGGLGKQITLKANFFQIISLPNETINQYHVIVGDGSRVPRKQSQLIWNSKEVKQYFGSSWMNSVYDGRSMCWSKGDIADGTIKVNIGSESHPREIEFSIQKSSKINLHTLSQFVNSKYSSDPQVLSSIMFLDLLLKKKPSETLFGFMHSFFTGENGVSLGGGVEAWKGFYQSIRPNQGFMSVNVDISSSAFWRNDSLLQILMEYTDCSNVRDLTRFDLKRLSRKFRFLKVTCQHRNNVGTDLANRVYSIEGFSSKSASDSFFVRRLNGEEQKISVAEYFLENHNVRLQYPNLPCILVKNGAMLPIEFCFVVKGQRYTAKLNSDQTANMIRFAVQRPFERVQQIDDFVHQMDWDTDPYLTQYGMKIQKKMLEVPARVLETPSIRYGGDCIERPVSGRWNLRGKRFLDPPRAPIRSWAVMCFTSTRRLPMRGIENFLQTYVQTLTSLGINFVMKKPPVLYADIRGSVEELCITLYKKAEQVGNAPPDYLFFILDKNSPEPYGSIKRVCNTMLGVPSQCAISKHILQSKPQYCANLGMKINVKVGGINCSLIPKSNPLGNVPTLILGGDVYHPGVGATGVSIASIVASVDLNGCKYTAVSRSQPRHQEVIEGMKDIVVYLLQGFRAMTKQQPQRIIYFRDGTSEGQFLSVINDELSQIKEACHSLSPKYNPKILVCTTQKRHHARFFIKNKSDGDRNGNPLPGTIIEKHVTHPYQYDFYLISHPSLQGVSVPVHYTVLHDEIQMPPDQFQTLCYNLCYVYARATSAVSLVPPVYYAHLVSNLARYQDVTADDTFVETSEASMDQEVKPLLALSSKLKTKMWYM F5CE397BF590D9E4 cid12-swi6-1 3238668 N/A 3238685 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3238686 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ers1-swi6-1 3238669 N/A 3238685 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3238687 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false tas3-hrr1-1 3238670 N/A 3238688 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3238689 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false hrr1-ers1-1 3238671 N/A 3238689 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3238687 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false O94717:p.Ser234Pro S234P mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false cid12-clr4-1 3238672 N/A 3238690 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3238686 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ers1-taf111-1 3238673 N/A 3238691 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3238687 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false chp1-rik1-1 3238674 N/A 3238692 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3238693 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rdp1-swi6-1 3238675 N/A 3238694 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3238685 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false hrr1-tas3-1 3238676 N/A 3238688 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3238689 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ers1-rpl3202-1 3238677 N/A 3238695 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3238687 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ago1-hrr1-1 3238678 N/A 3238696 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3238689 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ers1-hrr1-1 3238679 N/A 3238689 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3238687 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ers1-swi6-2 3238680 N/A 3238685 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3238687 unspecified role unspecified role unspecified role unspecified role O94717:p.Ser234Pro S234P mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false swi6-ers1-1 3238681 N/A 3238685 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3238687 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false O94717:p.Ser234Pro S234P mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false hrr1-ers1-2 3238682 N/A 3238689 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3238687 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ers1-hrr1-2 3238683 N/A 3238689 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3238687 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false ers1-tas3-1 3238684 N/A 3238687 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3238688 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false