DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ west-2012-1 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined West AL., Evans SE., González JM., Carter LG., Tsuruta H., Pozharski E., Michel SL. DIP original experiment: DIP-251587X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Ni(II) coordination to mixed sites modulates DNA binding of HpNikR via a long-range effect. West AL., Evans SE., González JM., Carter LG., Tsuruta H., Pozharski E., Michel SL. Only protein-protein interactions imex curation west-2012-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined West AL., Evans SE., González JM., Carter LG., Tsuruta H., Pozharski E., Michel SL. DIP original experiment: DIP-251588X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Ni(II) coordination to mixed sites modulates DNA binding of HpNikR via a long-range effect. West AL., Evans SE., González JM., Carter LG., Tsuruta H., Pozharski E., Michel SL. Only protein-protein interactions imex curation nikr_helpy Putative nickel-responsive regulator HP_1338 protein protein helpy Helicobacter pylori Campylobacter pylori MDTPNKDDSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAEDNPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKASSFEYNE nikr_helpy-1 3238341 N/A 3238343 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false nikr_helpy-2 3238342 N/A 3238343 unspecified role unspecified role unspecified role unspecified role Region 58-148 Region 58-148 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false