DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hohl-2012-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hohl M., Briand C., Grütter MG., Seeger MA. DIP original experiment: DIP-250890X Nature structural & molecular biology 2012 IMEx Crystal structure of a heterodimeric ABC transporter in its inward-facing conformation. Hohl M., Briand C., Grütter MG., Seeger MA. Only protein-protein interactions imex curation hohl-2012-2 ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Hohl M., Briand C., Grütter MG., Seeger MA. DIP original experiment: DIP-250893X Nature structural & molecular biology 2012 IMEx Crystal structure of a heterodimeric ABC transporter in its inward-facing conformation. Hohl M., Briand C., Grütter MG., Seeger MA. Only protein-protein interactions imex curation hohl-2012-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hohl M., Briand C., Grütter MG., Seeger MA. DIP original experiment: DIP-250891X Nature structural & molecular biology 2012 IMEx Crystal structure of a heterodimeric ABC transporter in its inward-facing conformation. Hohl M., Briand C., Grütter MG., Seeger MA. Only protein-protein interactions imex curation hohl-2012-4 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Hohl M., Briand C., Grütter MG., Seeger MA. DIP original experiment: DIP-250892X Nature structural & molecular biology 2012 IMEx Crystal structure of a heterodimeric ABC transporter in its inward-facing conformation. Hohl M., Briand C., Grütter MG., Seeger MA. Only protein-protein interactions imex curation y288_thema Uncharacterized ABC transporter ATP-binding protein TM_0288 TM_0288 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MPEIRRRPHGPILEKPALKNPTATLRRLLGYLRPHTFTLIMVFVFVTVSSILGVLSPYLIGKTIDVVFVPRRFDLLPRYMLILGTIYALTSLLFWLQGKIMLTLSQDVVFRLRKELFEKLQRVPVGFFDRTPHGDIISRVINDVDNINNVLGNSIIQFFSGIVTLAGAVIMMFRVNVILSLVTLSIVPLTVLITQIVSSQTRKYFYENQRVLGQLNGIIEEDISGLTVIKLFTREEKEMEKFDRVNESLRKVGTKAQIFSGVLPPLMNMVNNLGFALISGFGGWLALKDIITVGTIATFIGYSRQFTRPLNELSNQFNMIQMALASAERIFEILDLEEEKDDPDAVELREVRGEIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQILVDGIDIRKIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEGKTSIIIAHRLNTIKNADLIIVLRDGEIVEMGKHDELIQKRGFYYELFTSQYGLVVEKE BDFA5A242F18393E q9wyc3_thema TM_0287 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MKTLARYLKPYWIFAVLAPLFMVVEVICDLSQPTLLARIVDEGIARGDFSLVLKTGILMLIVALIGAVGGIGCTVFASYASQNFGADLRRDLFRKVLSFSISNVNRFHTSSLITRLTNDVTQLQNLVMMLLRIVVRAPLLFVGGIVMAVSINVKLSSVLIFLIPPIVLLFVWLTKKGNPLFRKIQESTDEVNRVVRENLLGVRVVRAFRREEYENENFRKANESLRRSIISAFSLIVFALPLFIFIVNMGMIAVLWFGGVLVRNNQMEIGSIMAYTNYLMQIMFSLMMIGNILNFIVRASASAKRVLEVLNEKPAIEEADNALALPNVEGSVSFENVEFRYFENTDPVLSGVNFSVKPGSLVAVLGETGSGKSTLMNLIPRLIDPERGRVEVDELDVRTVKLKDLRGHISAVPQETVLFSGTIKENLKWGREDATDDEIVEAAKIAQIHDFIISLPEGYDSRVERGGRNFSGGQKQRLSIARALVKKPKVLILDDCTSSVDPITEKRILDGLKRYTKGCTTFIITQKIPTALLADKILVLHEGKVAGFGTHKELLEHCKPYREIYESQFGNGVMNDA A53DFED7694B8F44 tm287-tm288-1 3238235 N/A 3238239 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3238240 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tm287-tm288-2 3238236 N/A 3238239 unspecified role unspecified role unspecified role unspecified role Q9WYC4:p.Thr486Cys T486C mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3238240 unspecified role unspecified role unspecified role unspecified role Q9WYC3:p.Asn105Cys N105C mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tm287-tm288-3 3238237 N/A 3238239 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3238240 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tm287-tm288-4 3238238 N/A 3238239 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3238240 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false