DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ levin-2012-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Levin AM., Bates DL., Ring AM., Krieg C., Lin JT., Su L., Moraga I., Raeber ME., Bowman GR., Novick P., Pande VS., Fathman CG., Boyman O., Garcia KC. DIP original experiment: DIP-249557X Nature 2012 IMEx Exploiting a natural conformational switch to engineer an interleukin-2 'superkine'. Levin AM., Bates DL., Ring AM., Krieg C., Lin JT., Su L., Moraga I., Raeber ME., Bowman GR., Novick P., Pande VS., Fathman CG., Boyman O., Garcia KC. Only protein-protein interactions imex curation levin-2012-2 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Levin AM., Bates DL., Ring AM., Krieg C., Lin JT., Su L., Moraga I., Raeber ME., Bowman GR., Novick P., Pande VS., Fathman CG., Boyman O., Garcia KC. DIP original experiment: DIP-249558X Nature 2012 IMEx Exploiting a natural conformational switch to engineer an interleukin-2 'superkine'. Levin AM., Bates DL., Ring AM., Krieg C., Lin JT., Su L., Moraga I., Raeber ME., Bowman GR., Novick P., Pande VS., Fathman CG., Boyman O., Garcia KC. Only protein-protein interactions imex curation levin-2012-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Levin AM., Bates DL., Ring AM., Krieg C., Lin JT., Su L., Moraga I., Raeber ME., Bowman GR., Novick P., Pande VS., Fathman CG., Boyman O., Garcia KC. DIP original experiment: DIP-249559X Nature 2012 IMEx Exploiting a natural conformational switch to engineer an interleukin-2 'superkine'. Levin AM., Bates DL., Ring AM., Krieg C., Lin JT., Su L., Moraga I., Raeber ME., Bowman GR., Novick P., Pande VS., Fathman CG., Boyman O., Garcia KC. Only protein-protein interactions imex curation il2_human Interleukin-2 T-cell growth factor IL2 protein protein human Homo sapiens Human MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFCQSIISTLT il2rb_human Interleukin-2 receptor subunit beta IL2RB High affinity IL-2 receptor subunit beta p70-75 Interleukin-15 receptor subunit beta IL15RB protein protein human Homo sapiens Human MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDTIPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDVQKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCTFPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVPDLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQELQGQDPTHLV p31785-1 Cytokine receptor common subunit gamma IL2RG Interleukin-2 receptor subunit gamma gammaC p64 protein protein human Homo sapiens Human MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET il2rb-il2-1 3238200 N/A 3238203 unspecified role unspecified role prey prey Mature protein Region 21-153 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P60568:p.Leu105Val L105V mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P60568:p.[Arg101Ile;Leu105Val] R101I/L105V mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P60568:p.[Gln94Asn;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile109Val;Ile112Phe] Q94N/L100F/R101D/L105V/I106V/I109V/I112F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P60568:p.[Pro85His;Gln94Asn;Leu100Val;Arg101Thr;Leu105Val;Ile106Val;Ile112Phe] P85H/Q94N/L100V/R101T/L105V/I106V/I112F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P60568:p.[Gln94His;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe] Q94H/L100F/R101D/L105V/I106V/I112F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P60568:p.[Gln94Ser;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe] Q94S/L100F/R101D/L105V/I106V/I112F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P60568:p.[Gln94Asn;Lys96Ile;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe] Q94N/K96I/L100F/R101D/L105V/I106V/I112F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P60568:p.[Gln94Ser;Arg101Thr;Leu105Val;Ile112Phe] Q94S/R101T/L105V/I112F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P60568:p.[Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe] L100F/R101D/L105V/I106V/I112F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3238204 unspecified role unspecified role bait bait Ectodomain Region 27-240 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false il2-il2rb-1 3238201 N/A 3238203 unspecified role unspecified role unspecified role unspecified role Mature protein Region 21-153 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P60568:p.[Gln94His;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe] Q94H/L100F/R101D/L105V/I106V/I112F mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P60568:p.[Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe] L100F/R101D/L105V/I106V/I112F mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3238204 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 27-240 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false il2-il2rb-2 3238202 N/A 3238205 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 56-254 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3238203 unspecified role unspecified role unspecified role unspecified role Mature protein Region 21-153 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P60568:p.[Gln94His;Leu100Phe;Arg101Asp;Leu105Val;Ile106Val;Ile112Phe] Q94H/L100F/R101D/L105V/I106V/I112F mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3238204 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 27-240 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false