DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chao-2012-1 trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down predetermined predetermined participant predetermined Chao WC., Kulkarni K., Zhang Z., Kong EH., Barford D. DIP original experiment: DIP-249551X Nature 2012 IMEx Structure of the mitotic checkpoint complex. Chao WC., Kulkarni K., Zhang Z., Kong EH., Barford D. Only protein-protein interactions imex curation chao-2012-2 trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Chao WC., Kulkarni K., Zhang Z., Kong EH., Barford D. DIP original experiment: DIP-249554X Nature 2012 IMEx Structure of the mitotic checkpoint complex. Chao WC., Kulkarni K., Zhang Z., Kong EH., Barford D. Only protein-protein interactions imex curation chao-2012-3 trini Trichoplusia ni (Cabbage looper) Cabbage looper x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chao WC., Kulkarni K., Zhang Z., Kong EH., Barford D. DIP original experiment: DIP-249555X Nature 2012 IMEx Structure of the mitotic checkpoint complex. Chao WC., Kulkarni K., Zhang Z., Kong EH., Barford D. Only protein-protein interactions imex curation chao-2012-4 trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Chao WC., Kulkarni K., Zhang Z., Kong EH., Barford D. DIP original experiment: DIP-249553X Nature 2012 IMEx Structure of the mitotic checkpoint complex. Chao WC., Kulkarni K., Zhang Z., Kong EH., Barford D. Only protein-protein interactions imex curation chao-2012-5 trini Trichoplusia ni (Cabbage looper) Cabbage looper ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Chao WC., Kulkarni K., Zhang Z., Kong EH., Barford D. DIP original experiment: DIP-249552X Nature 2012 IMEx Structure of the mitotic checkpoint complex. Chao WC., Kulkarni K., Zhang Z., Kong EH., Barford D. Only protein-protein interactions imex curation slp1_schpo WD repeat-containing protein slp1 slp1 SPAC821.08c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEIAGNSSTISPTFSTPTKKRNLVFPNSPITPLHQQALLGRNGRSSKRCSPKSSFIRNSPKIDVVNTDWSIPLCGSPRNKSRPASRSDRFIPSRPNTANAFVNSISSDVPFDYSESVAEACGFDLNTRVLAFKLDAPEAKKPVDLRTQHNRPQRPVVTPAKRRFNTTPERVLDAPGIIDDYYLNLLDWSNLNVVAVALERNVYVWNADSGSVSALAETDESTYVASVKWSHDGSFLSVGLGNGLVDIYDVESQTKLRTMAGHQARVGCLSWNRHVLSSGSRSGAIHHHDVRIANHQIGTLQGHSSEVCGLAWRSDGLQLASGGNDNVVQIWDARSSIPKFTKTNHNAAVKAVAWCPWQSNLLATGGGTMDKQIHFWNAATGARVNTVDAGSQVTSLIWSPHSKEIMSTHGFPDNNLSIWSYSSSGLTKQVDIPAHDTRVLYSALSPDGRILSTAASDENLKFWRVYDGDHVKRPIPITKTPSSSITIR 52E021FD4EECE5DE mad3_schpo Mitotic spindle checkpoint component mad3 mad3 SPCC1795.01c SPCC895.02 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEPLDAGKNWVHMDVIEQSKENIEPRKAGHSASALAKSSSRNHTEKEVAGLQKERMGHERKIETSESLDDPLQVWIDYIKWTLDNFPQGETKTSGLVTLLERCTREFVRNPLYKDDVRYLRIWMQYVNYIDEPVELFSFLAHHHIGQESSIFYEEYANYFESRGLFQKADEVYQKGKRMKAKPFLRFQQKYQQFTHRWLEFAPQSFSSNTNSVNPLQTTFESTNIQEISQSRTKISKPKFKFSVYSDADGSGKDGQPGTWQTLGTVDQRRKENNISATSWVGEKLPLKSPRKLDPLGKFQVHCDEEVSKE EEC3EA6D3790C4BF mad2_schpo Mitotic spindle checkpoint component mad2 mad2 SPBC20F10.06 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSSVPIRTNFSLKGSSKLVSEFFEYAVNSILFQRGIYPAEDFKVVRKYGLNMLVSVDEEVKTYIRKIVSQLHKWMFAKKIQKLILVITSKCSGEDLERWQFNVEMVDTADQFQNIGNKEDELRVQKEIQALIRQITATVTFLPQLEEQCTFNVLVYADKDSEVPTDWVDSDPRILRDAEQVQLRSFSTSMHKIDCQVAYRVNP DC9D1D213450C925 cdc20-mad2-4 3238163 N/A 3238168 unspecified role unspecified role bait bait Region 87-488 Region 87-488 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3238169 unspecified role unspecified role prey prey Region 1-223 Region 1-223 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3238170 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false cdc20-mad2-5 3238164 N/A 3238168 unspecified role unspecified role unspecified role unspecified role Region 87-488 Region 87-488 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3238170 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false cdc20-mad2-6 3238165 N/A 3238168 unspecified role unspecified role unspecified role unspecified role Region 87-488 Region 87-488 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3238169 unspecified role unspecified role unspecified role unspecified role Region 1-223 Region 1-223 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3238170 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false cdc20-mad2-7 3238166 N/A 3238168 unspecified role unspecified role unspecified role unspecified role Region 87-488 Region 87-488 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3238169 unspecified role unspecified role unspecified role unspecified role Region 1-223 Region 1-223 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3238170 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false cdc20-mad2-8 3238167 N/A 3238168 unspecified role unspecified role unspecified role unspecified role Region 87-488 Region 87-488 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3238169 unspecified role unspecified role unspecified role unspecified role Region 1-223 Region 1-223 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3238170 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false