DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ volbeda-2012-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Volbeda A., Amara P., Darnault C., Mouesca JM., Parkin A., Roessler MM., Armstrong FA., Fontecilla-Camps JC. DIP original experiment: DIP-251569X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx X-ray crystallographic and computational studies of the O2-tolerant [NiFe]-hydrogenase 1 from Escherichia coli. Volbeda A., Amara P., Darnault C., Mouesca JM., Parkin A., Roessler MM., Armstrong FA., Fontecilla-Camps JC. Only protein-protein interactions imex curation volbeda-2012-2 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Volbeda A., Amara P., Darnault C., Mouesca JM., Parkin A., Roessler MM., Armstrong FA., Fontecilla-Camps JC. DIP original experiment: DIP-251570X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx X-ray crystallographic and computational studies of the O2-tolerant [NiFe]-hydrogenase 1 from Escherichia coli. Volbeda A., Amara P., Darnault C., Mouesca JM., Parkin A., Roessler MM., Armstrong FA., Fontecilla-Camps JC. Only protein-protein interactions imex curation mbhl_ecoli Hydrogenase-1 large chain Membrane-bound hydrogenase 1 large subunit NiFe hydrogenase hyaB b0973 JW0955 protein protein ecoli Escherichia coli (strain K12) MSTQYETQGYTINNAGRRLVVDPITRIEGHMRCEVNINDQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERICGVCTGVHALASVYAIEDAIGIKVPDNANIIRNIMLATLWCHDHLVHFYQLAGMDWIDVLDALKADPRKTSELAQSLSSWPKSSPGYFFDVQNRLKKFVEGGQLGIFRNGYWGHPQYKLPPEANLMGFAHYLEALDFQREIVKIHAVFGGKNPHPNWIVGGMPCAINIDESGAVGAVNMERLNLVQSIITRTADFINNVMIPDALAIGQFNKPWSEIGTGLSDKCVLSYGAFPDIANDFGEKSLLMPGGAVINGDFNNVLPVDLVDPQQVQEFVDHAWYRYPNDQVGRHPFDGITDPWYNPGDVKGSDTNIQQLNEQERYSWIKAPRWRGNAMEVGPLARTLIAYHKGDAATVESVDRMMSALNLPLSGIQSTLGRILCRAHEAQWAAGKLQYFFDKLMTNLKNGNLATASTEKWEPATWPTECRGVGFTEAPRGALGHWAAIRDGKIDLYQCVVPTTWNASPRDPKGQIGAYEAALMNTKMAIPEQPLEILRTLHSFDPCLACSTHVLGDDGSELISVQVR mbhs_ecoli Hydrogenase-1 small chain Membrane-bound hydrogenase 1 small subunit NiFe hydrogenase JW0954 b0972 hyaA protein protein ecoli Escherichia coli (strain K12) MNNEETFYQAMRRQGVTRRSFLKYCSLAATSLGLGAGMAPKIAWALENKPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRVVDIPQMGTHSTADTVGLTALGVVAAAVGVHAVASAVDQRRRHNQQPTETEHQPGNEDKQA hyaa-hyab-7 3238081 N/A 3238083 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3238084 unspecified role unspecified role unspecified role unspecified role Region 46-372 Region 46-372 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false hyaa-hyab-8 3238082 N/A 3238083 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3238084 unspecified role unspecified role bait bait Region 46-372 Region 46-372 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag experimental feature experimental feature c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false