DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kuwabara-2012-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kuwabara N., Murayama Y., Hashimoto H., Kokabu Y., Ikeguchi M., Sato M., Mayanagi K., Tsutsui Y., Iwasaki H., Shimizu T. DIP original experiment: DIP-249283X Structure (London, England : 1993) 2012 IMEx Mechanistic insights into the activation of Rad51-mediated strand exchange from the structure of a recombination activator, the Swi5-Sfr1 complex. Kuwabara N., Murayama Y., Hashimoto H., Kokabu Y., Ikeguchi M., Sato M., Mayanagi K., Tsutsui Y., Iwasaki H., Shimizu T. Only protein-protein interactions imex curation kuwabara-2012-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kuwabara N., Murayama Y., Hashimoto H., Kokabu Y., Ikeguchi M., Sato M., Mayanagi K., Tsutsui Y., Iwasaki H., Shimizu T. DIP original experiment: DIP-249286X Structure (London, England : 1993) 2012 IMEx Mechanistic insights into the activation of Rad51-mediated strand exchange from the structure of a recombination activator, the Swi5-Sfr1 complex. Kuwabara N., Murayama Y., Hashimoto H., Kokabu Y., Ikeguchi M., Sato M., Mayanagi K., Tsutsui Y., Iwasaki H., Shimizu T. Only protein-protein interactions imex curation kuwabara-2012-3 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Kuwabara N., Murayama Y., Hashimoto H., Kokabu Y., Ikeguchi M., Sato M., Mayanagi K., Tsutsui Y., Iwasaki H., Shimizu T. DIP original experiment: DIP-249284X Structure (London, England : 1993) 2012 IMEx Mechanistic insights into the activation of Rad51-mediated strand exchange from the structure of a recombination activator, the Swi5-Sfr1 complex. Kuwabara N., Murayama Y., Hashimoto H., Kokabu Y., Ikeguchi M., Sato M., Mayanagi K., Tsutsui Y., Iwasaki H., Shimizu T. Only protein-protein interactions imex curation kuwabara-2012-4 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Kuwabara N., Murayama Y., Hashimoto H., Kokabu Y., Ikeguchi M., Sato M., Mayanagi K., Tsutsui Y., Iwasaki H., Shimizu T. DIP original experiment: DIP-249285X Structure (London, England : 1993) 2012 IMEx Mechanistic insights into the activation of Rad51-mediated strand exchange from the structure of a recombination activator, the Swi5-Sfr1 complex. Kuwabara N., Murayama Y., Hashimoto H., Kokabu Y., Ikeguchi M., Sato M., Mayanagi K., Tsutsui Y., Iwasaki H., Shimizu T. Only protein-protein interactions imex curation sfr1_schpo Swi5-dependent recombination DNA repair protein 1 sfr1 dds20 SPBC28F2.07 DNA repair protein dds20 Meiotically up-regulated gene 13 protein mug13 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSQTINSELNENATSQCKEDLKVSLSESDLRDSQGQLGIENPPKCNNSGNHSDNLGFIEQSETVHPENEKALTPDLRDTKIHTSLPITTPFSKKRAREAKNILLKPFKSPLRQTASPQVADTNLKPSLAVTNLNSDETNTSSEPVTSPLRTTPNSIKRQKRLFKSPISNCLNPKSDPEITQLLSRRLKLEKEVRNLQEQLITAETARKVEAKNEDKDLQTLIQKWKNAAQQAAEVLFKPMAERIRLAGGVTQSFRIEEGENKGQIQEVRTEFTMSMFLNQFGVPVHLMSFDEENGDWKS EFE91ABDE965C82D swi5_schpo Mating-type switching protein swi5 swi5 SPBC409.03 DNA repair protein swi5 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEKSQLESRVHLLEQQKEQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIRDIALGMIGKVAEHEKCTSVELFDRFGVNGSE DAA84500D8A84B71 rad51_schpo DNA repair protein rhp51 rhp51 rad51 SPAC644.14c RAD51 homolog protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MADTEVEMQVSAADTNNNENGQAQSNYEYDVNVQDEEDEAAAGPMPLQMLEGNGITASDIKKIHEAGYYTVESIAYTPKRQLLLIKGISEAKADKLLGEASKLVPMGFTTATEYHIRRSELITITTGSKQLDTLLQGGVETGSITELFGEFRTGKSQICHTLAVTCQLPIDMGGGEGKCLYIDTEGTFRPVRLLAVADRYGLNGEEVLDNVAYARAYNADHQLELLQQAANMMSESRFSLLVVDSCTALYRTDFSGRGELSARQMHLARFMRTLQRLADEFGIAVVITNQVVAQVDGISFNPDPKKPIGGNILAHSSTTRLSLRKGRGEQRICKIYDSPCLPESEAIFAINSDGVGDPKEIIAPV 9F26EB9FA4F3C2BA srf1-swi5-1 3237769 N/A 3237773 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 181-299 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237774 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false swi5-1 3237770 N/A 3237774 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false srf1-swi5-2 3237771 N/A 3237773 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 181-299 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237774 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rad51-srf1-1 3237772 N/A 3237775 unspecified role unspecified role bait bait spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3237773 unspecified role unspecified role prey prey N-terminal domain Region 1-177 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false