DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ fujii-2012-1 shifl Shigella flexneri 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Fujii T., Cheung M., Blanco A., Kato T., Blocker AJ., Namba K. DIP original experiment: DIP-251556X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of a type III secretion needle at 7-Å resolution provides insights into its assembly and signaling mechanisms. Fujii T., Cheung M., Blanco A., Kato T., Blocker AJ., Namba K. Only protein-protein interactions imex curation mxih_shifl Protein MxiH mxiH CP0137 protein protein shifl Shigella flexneri MSVTVPNDDWTLSSLSETFDDGTQTLQGELTLALDKLAKNPSNPQLLAEYQSKLSEYTLYRNAQSNTVKVIKDVDAAIIQNFR mxih-2 3237594 N/A 3237595 unspecified role unspecified role unspecified role unspecified role shifl Shigella flexneri direct interaction direct interaction false false false