DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ murachelli-2012-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250868X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation murachelli-2012-2 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250865X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation murachelli-2012-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250879X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation murachelli-2012-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250871X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation murachelli-2012-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250875X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation murachelli-2012-6 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250878X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation murachelli-2012-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250869X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation murachelli-2012-8 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250876X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation murachelli-2012-9 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250872X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation murachelli-2012-10 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250866X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation murachelli-2012-11 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250877X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation murachelli-2012-12 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250873X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation murachelli-2012-13 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250870X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation murachelli-2012-14 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250881X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation murachelli-2012-15 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250867X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation murachelli-2012-16 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250880X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation murachelli-2012-17 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. DIP original experiment: DIP-250874X Nature structural & molecular biology 2012 IMEx The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex. Murachelli AG., Ebert J., Basquin C., Le Hir H., Conti E. Only protein-protein interactions imex curation q15287-1 RNA-binding protein with serine-rich domain 1 SR-related protein LDC2 RNPS1 LDC2 protein protein human Homo sapiens Human MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRDKTRKRRSASSGSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSSSGSPSPSRRRHDNRRRSRSKSKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVLAPWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVRRRSRSPGRRRHRSRSSSNSSR pinin_human Pinin 140 kDa nuclear and cell adhesion-related phosphoprotein Domain-rich serine protein Melanoma metastasis clone A protein Desmosome-associated protein SR-like protein Nuclear protein SDK3 PNN DRS MEMA protein protein human Homo sapiens Human MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGSLLLRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQESDPEDDDVKKPALQSSVVATSKERTRRDLIQDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATERQKRRQEIEQKLEVQAEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRNEEQKAEQEEGKVAQREEELEETGNQHNDVEIEEAGEEEEKEIAIVHSDAEKEQEEEEQKQEMEVKMEEETEVRESEKQQDSQPEEVMDVLEMVENVKHVIADQEVMETNRVESVEPSENEASKELEPEMEFEIEPDKECKTLSPGKENVSALDMEKESEEKEEKESEPQPEPVAQPQPQSQPQLQLQSQSQPVLQSQPPSQPEDLSLAVLQPTPQVTQEQGHLLPERKDFPVESVKLTEVPVEPVLTVHPESKSKTKTRSRSRGRARNKTSKSRSRSSSSSSSSSSSTSSSSGSSSSSGSSSSRSSSSSSSSTSGSSSRDSSSSTSSSSESRSRSRGRGHNRDRKHRRSVDRKRRDTSGLERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSRSGKRSSRSERDRKSDRKDKRR sap18_human Histone deacetylase complex subunit SAP18 18 kDa Sin3-associated polypeptide Sin3-associated polypeptide p18 Cell growth-inhibiting gene 38 protein 2HOR0202 SAP18 GIG38 protein protein human Homo sapiens Human MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRMRPY sap18_mouse Histone deacetylase complex subunit SAP18 Sap18 18 kDa Sin3-associated polypeptide Sin3-associated polypeptide p18 protein protein mouse Mus musculus Mouse MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPSSGRMRPY q9vj12_drome hkl Acn acn CG10437 Ba Dmel\CG10473 dAcn dacn l(2)37Ba Dmel_CG10473 CG10473 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MRRRSERKKSSSPAPVPVAVARRSRRSRKVSENEKTEVETPVVAQNNEAECPKVPPASQEINEARASSEERAGSGASPVRRSRGSRTTPRKRTESKGGDKKVDTIPEEEPENGKDVEKDAVEEEKTVAPPAANESESEDRAKTEDQQAQDDESCAEPAVVKDDDVEKEDLKPQQEVPTSTDDDTKQSEPEQEVKVPSPSSKDEEHLKTTSDVLDIQTEEVDERDEEASAPAERRETKKRHKEQIKEQQPAEEEEHKENHKQIDENPEQIHDEPADLSNDKHDPCLNSSATNTTGAPVLQQQRSVRKRKWLTNKKSSDRTPPVLAISTDSLKNIIADVVQPVPLSDVQLESSSEEEGLVTSDRDSERSASPAPPSEASKDRDNKGNTANTCDTTAEASADNEGAGAAPPAAADTVSAQVSLSKATVSTAAPHIVRDPSPARNRASHVLYITNLVRPFTVLQLKGLLARTGKIVEEDGFWIDRIKSKCYVAYSTEDEAIETRHALHGVRWPVSNPKCLNVDFGSRTDMDRAILSTKDEAPRYGQENTRDNQQSGNAWSRLEPSDKKPARPVREWDVGKKEPSDHDKHSNDRRRDSKDRLDSRSRDAERAGQERKRSRDREGRGRDRERERLDRNAHARSRSGSPASKTKKENEPPIRLLDDLFRKTKGTPCIYWLPLTPEAIAEKEAFRQKRIEEHKLRIKEREERQKEREKDRDRQRETRRNRSNERRRSRSRERERRRY q9ukv3-2 Apoptotic chromatin condensation inducer in the nucleus S' ACIN1 ACINUS KIAA0670 protein protein human Homo sapiens Human MSPADRCRSANTIEPATTSSLALFLLLQRDQSSRTRGLPEEKEEVTMDTSENRPENDVPEPPMPIADQVSNDDRPEGSVEDEEKKESSLPKSFKRKISVVSATKGVPAGNSDTEGGQPGRKRRWGASTATTQKKPSISITTESLKSLIPDIKPLAGQEAVVDLHADDSRISEDETERNGDDGTHDKGLKICRTVTQVVPAEGQENGQREEEEEEKEPEAEPPVPPQVSVEVALPPPAEHEVKKVTLGDTLTRRSISQQKSGVSITIDDPVRTAQVPSPPRGKISNIVHISNLVRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWPQSNPKFLCADYAEQDELDYHRGLLVDRPSETKTEEQGIPRPLHPPPPPPVQPPQHPRAEQREQERAVREQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAERAKEREKRRKEQEEEEQKEREKEAERERNRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGRERDRRDTKRHSRSRSRSTPVRDRGGRR q9ukv3-1 Apoptotic chromatin condensation inducer in the nucleus ACIN1 ACINUS KIAA0670 L protein protein human Homo sapiens Human MWRRKHPRTSGGTRGVLSGNRGVEYGSGRGHLGTFEGRWRKLPKMPEAVGTDPSTSRKMAELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVKRLKGALMLENLQKHSTPHAAFQPNSQIGEEMSQNSFIKQYLEKQQELLRQRLEREAREAAELEEASAESEDEMIHPEGVASLLPPDFQSSLERPELELSRHSPRKSSSISEEKGDSDDEKPRKGERRSSRVRQARAAKLSEGSQPAEEEEDQETPSRNLRVRADRNLKTEEEEEEEEEEEEDDEEEEGDDEGQKSREAPILKEFKEEGEEIPRVKPEEMMDERPKTRSQEQEVLERGGRFTRSQEEARKSHLARQQQEKEMKTTSPLEEEEREIKSSQGLKEKSKSPSPPRLTEDRKKASLVALPEQTASEEETPPPLLTKEASSPPPHPQLHSEEEIEPMEGPAPAVLIQLSPPNTDADTRELLVSQHTVQLVGGLSPLSSPSDTKAESPAEKVPEESVLPLVQKSTLADYSAQKDLEPESDRSAQPLPLKIEELALAKGITEECLKQPSLEQKEGRRASHTLLPSHRLKQSADSSSSRSSSSSSSSSRSRSRSPDSSGSRSHSPLRSKQRDVAQARTHANPRGRPKMGSRSTSESRSRSRSRSRSASSNSRKSLSPGVSRDSSTSYTETKDPSSGQEVATPPVPQLQVCEPKERTSTSSSSVQARRLSQPESAEKHVTQRLQPERGSPKKCEAEEAEPPAATQPQTSETQTSHLPESERIHHTVEEKEEVTMDTSENRPENDVPEPPMPIADQVSNDDRPEGSVEDEEKKESSLPKSFKRKISVVSATKGVPAGNSDTEGGQPGRKRRWGASTATTQKKPSISITTESLKSLIPDIKPLAGQEAVVDLHADDSRISEDETERNGDDGTHDKGLKICRTVTQVVPAEGQENGQREEEEEEKEPEAEPPVPPQVSVEVALPPPAEHEVKKVTLGDTLTRRSISQQKSGVSITIDDPVRTAQVPSPPRGKISNIVHISNLVRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWPQSNPKFLCADYAEQDELDYHRGLLVDRPSETKTEEQGIPRPLHPPPPPPVQPPQHPRAEQREQERAVREQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAERAKEREKRRKEQEEEEQKEREKEAERERNRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGRERDRRDTKRHSRSRSRSTPVRDRGGRR mint pnn-rnps1-3 3237464 N/A 3237481 unspecified role unspecified role unspecified role unspecified role RRM domain Region 159-244 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237482 unspecified role unspecified role unspecified role unspecified role Region 221-284 Region 221-284 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sap18-pnn-1 3237465 N/A 3237483 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false This tag was used for western blot detection. human Homo sapiens Human N/A 3237481 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3237482 unspecified role unspecified role prey prey Region 221-284 Region 221-284 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false acn-rnps1-1 3237466 N/A 3237484 unspecified role unspecified role unspecified role unspecified role Region 6-143 Region 6-143 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237485 unspecified role unspecified role unspecified role unspecified role Region 617-710 Region 617-710 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237481 unspecified role unspecified role unspecified role unspecified role RRM domain Region 159-244 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false acin1-rnps1-1 3237467 N/A 3237483 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3237481 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper n/a 3237486 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false sap18-acin1-1 3237468 N/A 3237483 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3237481 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3237486 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false rnps1-acin1-1 3237469 N/A 3237487 unspecified role unspecified role prey prey Region 1171-1250 Region 1171-1250 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237484 unspecified role unspecified role prey prey Region 6-143 Region 6-143 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237481 unspecified role unspecified role bait bait CBP-tag CBP-tag cam tag calmodulin binding protein tag cam tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false sap18-acin1-2 3237470 n/a 3237486 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3237483 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false This tag was used for western blot detection. human Homo sapiens Human N/A 3237481 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false rnps1-acn-1 3237471 N/A 3237484 unspecified role unspecified role prey prey Region 6-143 Region 6-143 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237485 unspecified role unspecified role prey prey Region 617-710 Region 617-710 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237481 unspecified role unspecified role bait bait RRM domain Region 159-244 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false acin1-rnps1-2 3237472 N/A 3237481 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper n/a 3237486 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false sap18-pnn-2 3237473 N/A 3237483 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false This tag was used for western blot detection. human Homo sapiens Human N/A 3237482 unspecified role unspecified role prey prey Region 221-284 Region 221-284 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false rnps1-acin1-2 3237474 N/A 3237487 unspecified role unspecified role prey prey Region 1171-1250 Region 1171-1250 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237484 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3237481 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false rnps1-acin1-3 3237475 N/A 3237483 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3237481 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3237486 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false pnn-rnps1-4 3237476 N/A 3237481 unspecified role unspecified role prey prey RRM domain Region 159-244 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3237482 unspecified role unspecified role bait bait Region 221-284 Region 221-284 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false acn-rnps1-2 3237477 N/A 3237484 unspecified role unspecified role unspecified role unspecified role Region 14-143 Region 14-143 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237485 unspecified role unspecified role unspecified role unspecified role Region 648-688 Region 648-688 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237481 unspecified role unspecified role unspecified role unspecified role RRM domain Region 159-244 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pnn-rnps1-5 3237478 N/A 3237484 unspecified role unspecified role unspecified role unspecified role Region 6-143 Region 6-143 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237481 unspecified role unspecified role unspecified role unspecified role RRM domain Region 159-244 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237482 unspecified role unspecified role unspecified role unspecified role Region 221-284 Region 221-284 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false acn-rnps1-3 3237479 N/A 3237485 unspecified role unspecified role unspecified role unspecified role Region 617-710 Region 617-710 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3237481 unspecified role unspecified role unspecified role unspecified role RRM domain Region 159-244 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rnps1-acin1-4 3237480 N/A 3237481 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3237486 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false