DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ maison-2012-1 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. DIP original experiment: DIP-256074X Nature structural & molecular biology 2012 IMEx The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. Only protein-protein interactions imex curation maison-2012-2 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. DIP original experiment: DIP-256078X Nature structural & molecular biology 2012 IMEx The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. Only protein-protein interactions imex curation maison-2012-3 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. DIP original experiment: DIP-256076X Nature structural & molecular biology 2012 IMEx The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. Only protein-protein interactions imex curation maison-2012-4 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. DIP original experiment: DIP-256075X Nature structural & molecular biology 2012 IMEx The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. Only protein-protein interactions imex curation maison-2012-5 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. DIP original experiment: DIP-256079X Nature structural & molecular biology 2012 IMEx The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. Only protein-protein interactions imex curation maison-2012-6 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. DIP original experiment: DIP-256077X Nature structural & molecular biology 2012 IMEx The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. Only protein-protein interactions imex curation cbx5_mouse Chromobox protein homolog 5 Cbx5 Hp1a Heterochromatin protein 1 homolog alpha protein protein mouse Mus musculus Mouse MGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSEGNKRKSSFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKESAKS senp7_mouse Sentrin-specific protease 7 Senp7 Kiaa1707 Susp2 SUMO-1-specific protease 2 Sentrin/SUMO-specific protease SENP7 protein protein mouse Mus musculus Mouse MDRARPGRRRASSEIVTEGKRKKSSPADLQKITKLLTVKSEDVLAQSPLSKLRGSECWWTRSLRNKVICLDHKKPKAARGCPPKGLPKRHLRVMLTNVLWTDLGREFRKTLPRKDANLCAPSKVQSDSLPSTSVDSIETCQRLDPLHQSLNLSERTPRVILTDIRQTELGRKYLKIPPVTEASLSDTANLKSEQLSSSSDGSLESCQSVNHHKSFLSESGPKPSRTGDVPAKEAACGGQKQGDDGGVTPEMAAPHPKDFNTGNKGCDYLEEGTSNKNTSYSYSEMDHTPVSRKRKKRGRSNFHDSHNSKTSLDKPTEHTKEEENDSSVSRKLEESGEDSHQDPAPPEGLAPESLESEATNLRSFAAGQEPDASAASGRASSPNKSLESSASSEVSENSSVAVKGEALTLKEASPPGGSSEESQLLISAEPIVVSSDEEGPVEHKNSVILKLQPPHEIMSENQGTSDPQLSELTLGACESVQVTSELFPYNPDVENISCIKSNSEMDLKLDFIFTCVYIGKIKGTPKGCVTFTKKYIKIPFQVSTNEISLTVDTARLKRFGLWESKDEDHSKRSHAILFLWLSSDYLQDIQTQLENPMLSQQSKANEFIFLELNSSISQREELKLKDIMMEISTKNGNLHLSCPLPWVQALPLFQDLSPQEISFLHYYYASASALPTAAGADMKKKSVSQPSNSDTIKPTYTFLHKQSSGCYSLSITSSPEEEWQEVRNTGPVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLLLEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPDLSVAQRRHRRVRTWTRHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDCPQTVSQQFQGQQSQHDHKMTDNDPHTTSTVSTSAEDSQSTEVNMSVPKKMCKRPCILILDSLKAASIQNTVQNLREYLEVEWEVKRKTHREFSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFQDPIVNFELPIHLEKWFPRHVIKTKREDIRELILKLHLQQQKGGSC sumo3_human Small ubiquitin-related modifier 3 SMT3 homolog 1 SUMO-2 SMT3H1 SUMO3 SMT3A Ubiquitin-like protein SMT3A protein protein human Homo sapiens Human MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF cbx3_mouse Chromobox protein homolog 3 Cbx3 Heterochromatin protein 1 homolog gamma Modifier 2 protein M32 protein protein mouse Mus musculus Mouse MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEDFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ cbx1_mouse Chromobox protein homolog 1 Cbx1 Cbx Heterochromatin protein 1 homolog beta Modifier 1 protein M31 Heterochromatin protein p25 protein protein mouse Mus musculus Mouse MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV senp7-cbx5-1 3237423 N/A 3237429 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3237430 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse physical association physical association false false false cbx5-sumo3-1 3237424 N/A 3237431 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse N/A 3237429 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse physical association physical association false false false senp7-cbx5-2 3237425 N/A 3237429 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3237430 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false senp7-cbx1-1 3237426 N/A 3237432 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3237433 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3237429 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3237430 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false cbx5-senp7-1 3237427 N/A 3237430 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3237429 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse physical association physical association false false false cbx5-sumo1-1 3237428 N/A 3237434 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse N/A 3237429 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse physical association physical association false false false