DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yang-2012-2 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Yang H., Zhang T., Tao Y., Wu L., Li HT., Zhou JQ., Zhong C., Ding J. DIP original experiment: DIP-249278X Structure (London, England : 1993) 2012 IMEx Saccharomyces cerevisiae MHF complex structurally resembles the histones (H3-H4)₂ heterotetramer and functions as a heterotetramer. Yang H., Zhang T., Tao Y., Wu L., Li HT., Zhou JQ., Zhong C., Ding J. Only protein-protein interactions imex curation yang-2012-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yang H., Zhang T., Tao Y., Wu L., Li HT., Zhou JQ., Zhong C., Ding J. DIP original experiment: DIP-249279X Structure (London, England : 1993) 2012 IMEx Saccharomyces cerevisiae MHF complex structurally resembles the histones (H3-H4)₂ heterotetramer and functions as a heterotetramer. Yang H., Zhang T., Tao Y., Wu L., Li HT., Zhou JQ., Zhong C., Ding J. Only protein-protein interactions imex curation yang-2012-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang H., Zhang T., Tao Y., Wu L., Li HT., Zhou JQ., Zhong C., Ding J. DIP original experiment: DIP-249280X Structure (London, England : 1993) 2012 IMEx Saccharomyces cerevisiae MHF complex structurally resembles the histones (H3-H4)₂ heterotetramer and functions as a heterotetramer. Yang H., Zhang T., Tao Y., Wu L., Li HT., Zhou JQ., Zhong C., Ding J. Only protein-protein interactions imex curation cenpx_yeast Inner kinetochore subunit MHF2 MHF2 MPH1-associated histone-fold protein 2 YDL160C-A CENP-X homolog Constitutive centromere-associated network protein MHF2 MHF histone-fold complex subunit 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKSPLELSHQDLERIVGLLLMDM 714F9504D55859BC cenps_yeast Inner kinetochore subunit MHF1 MHF1 MPH1-associated histone-fold protein 1 YOL086W-A CENP-S homolog Constitutive centromere-associated network protein MHF1 MHF histone-fold complex subunit 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNDDEDRAQLKARLWIRVEERLQQVLSSEDIKYTPRFINSLLELAYLQLGEMGSDLQAFARHAGRGVVNKSDLMLYLRKQPDLQERVTQE A1B7F953FED34C1C mhf2-mhf1-1 3236525 N/A 3236528 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3236529 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false mhf1-mhf2-1 3236526 N/A 3236528 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3236529 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mhf1-mhf2-2 3236527 N/A 3236528 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3236529 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false