DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ cox-2012-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Cox G., Thompson GS., Jenkins HT., Peske F., Savelsbergh A., Rodnina MV., Wintermeyer W., Homans SW., Edwards TA., O'Neill AJ. DIP original experiment: DIP-251492X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Ribosome clearance by FusB-type proteins mediates resistance to the antibiotic fusidic acid. Cox G., Thompson GS., Jenkins HT., Peske F., Savelsbergh A., Rodnina MV., Wintermeyer W., Homans SW., Edwards TA., O'Neill AJ. Only protein-protein interactions imex curation cox-2012-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Cox G., Thompson GS., Jenkins HT., Peske F., Savelsbergh A., Rodnina MV., Wintermeyer W., Homans SW., Edwards TA., O'Neill AJ. DIP original experiment: DIP-251495X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Ribosome clearance by FusB-type proteins mediates resistance to the antibiotic fusidic acid. Cox G., Thompson GS., Jenkins HT., Peske F., Savelsbergh A., Rodnina MV., Wintermeyer W., Homans SW., Edwards TA., O'Neill AJ. Only protein-protein interactions imex curation cox-2012-3 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Cox G., Thompson GS., Jenkins HT., Peske F., Savelsbergh A., Rodnina MV., Wintermeyer W., Homans SW., Edwards TA., O'Neill AJ. DIP original experiment: DIP-251493X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Ribosome clearance by FusB-type proteins mediates resistance to the antibiotic fusidic acid. Cox G., Thompson GS., Jenkins HT., Peske F., Savelsbergh A., Rodnina MV., Wintermeyer W., Homans SW., Edwards TA., O'Neill AJ. Only protein-protein interactions imex curation cox-2012-4 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Cox G., Thompson GS., Jenkins HT., Peske F., Savelsbergh A., Rodnina MV., Wintermeyer W., Homans SW., Edwards TA., O'Neill AJ. DIP original experiment: DIP-251496X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Ribosome clearance by FusB-type proteins mediates resistance to the antibiotic fusidic acid. Cox G., Thompson GS., Jenkins HT., Peske F., Savelsbergh A., Rodnina MV., Wintermeyer W., Homans SW., Edwards TA., O'Neill AJ. Only protein-protein interactions imex curation cox-2012-5 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Cox G., Thompson GS., Jenkins HT., Peske F., Savelsbergh A., Rodnina MV., Wintermeyer W., Homans SW., Edwards TA., O'Neill AJ. DIP original experiment: DIP-251494X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Ribosome clearance by FusB-type proteins mediates resistance to the antibiotic fusidic acid. Cox G., Thompson GS., Jenkins HT., Peske F., Savelsbergh A., Rodnina MV., Wintermeyer W., Homans SW., Edwards TA., O'Neill AJ. Only protein-protein interactions imex curation efg_staa8 Elongation factor G fusA SAOUHSC_00529 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MAREFSLEKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQDRGITITSAATTAAWEGHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKLGANFEYSVSTLHDRLQANAAPIQLPIGAEDEFEAIIDLVEMKCFKYTNDLGTEIEEIEIPEDHLDRAEEARASLIEAVAETSDELMEKYLGDEEISVSELKEAIRQATTNVEFYPVLCGTAFKNKGVQLMLDAVIDYLPSPLDVKPIIGHRASNPEEEVIAKADDSAEFAALAFKVMTDPYVGKLTFFRVYSGTMTSGSYVKNSTKGKRERVGRLLQMHANSRQEIDTVYSGDIAAAVGLKDTGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQDKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHLDILVDRMKKEFNVECNVGAPMVSYRETFKSSAQVQGKFSRQSGGRGQYGDVHIEFTPNETGAGFEFENAIVGGVVPREYIPSVEAGLKDAMENGVLAGYPLIDVKAKLYDGSYHDVDSSEMAFKIAASLALKEAAKKCDPVILEPMMKVTIEMPEEYMGDIMGDVTSRRGRVDGMEPRGNAQVVNAYVPLSEMFGYATSLRSNTQGRGTYTMYFDHYAEVPKSIAEDIIKKNKGE q8gny5_staau far1 fusB protein protein staau Staphylococcus aureus MKTMIYPHQYNYIRSVILRLKNVYKTVNDKETVKVIQSETYNDINEIFGHIDDDIEESLKVLMNIRLSNKEIEAILNKFLEYVVPFELPSPQKLQKVFKKVKKIKIPQFEEYDLKVSSFVGWNELASNRKYIIYYDEKKQLKGLYGEISNQVVKGFCTICNKESNVSLFMKKSKTNSDGQYVKKGDYICRDSIHCNKQLTDINQFYNFIDKLD fusc Putative fusidic acid resistance protein protein protein staas Staphylococcus aureus (strain MSSA476) This sequence has been withdrawn from Uniprot. The sequence has been withdrawn from uniprot. far1-fusa-1 3294476 N/A 3294481 unspecified role unspecified role unspecified role unspecified role Region 401-691 Region 401-691 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3294482 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false fusa-fusc-1 3294477 N/A 3294483 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3294481 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false far1-fusa-2 3294478 N/A 3294481 unspecified role unspecified role unspecified role unspecified role Region 401-691 Region 401-691 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3294482 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false fusa-fusc-2 3294479 N/A 3294483 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3294481 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false far1-fusa-3 3294480 N/A 3294481 unspecified role unspecified role unspecified role unspecified role Region 401-691 Region 401-691 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3294482 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false