DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ alpadi-2012-1 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. DIP original experiment: DIP-249344X PLoS biology 2012 IMEx Sequential analysis of trans-SNARE formation in intracellular membrane fusion. Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. Only protein-protein interactions imex curation alpadi-2012-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. DIP original experiment: DIP-249352X PLoS biology 2012 IMEx Sequential analysis of trans-SNARE formation in intracellular membrane fusion. Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. Only protein-protein interactions imex curation alpadi-2012-3 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. DIP original experiment: DIP-249348X PLoS biology 2012 IMEx Sequential analysis of trans-SNARE formation in intracellular membrane fusion. Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. Only protein-protein interactions imex curation alpadi-2012-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. DIP original experiment: DIP-249355X PLoS biology 2012 IMEx Sequential analysis of trans-SNARE formation in intracellular membrane fusion. Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. Only protein-protein interactions imex curation alpadi-2012-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. DIP original experiment: DIP-249357X PLoS biology 2012 IMEx Sequential analysis of trans-SNARE formation in intracellular membrane fusion. Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. Only protein-protein interactions imex curation alpadi-2012-6 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. DIP original experiment: DIP-249345X PLoS biology 2012 IMEx Sequential analysis of trans-SNARE formation in intracellular membrane fusion. Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. Only protein-protein interactions imex curation alpadi-2012-7 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. DIP original experiment: DIP-249349X PLoS biology 2012 IMEx Sequential analysis of trans-SNARE formation in intracellular membrane fusion. Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. Only protein-protein interactions imex curation alpadi-2012-8 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. DIP original experiment: DIP-249353X PLoS biology 2012 IMEx Sequential analysis of trans-SNARE formation in intracellular membrane fusion. Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. Only protein-protein interactions imex curation alpadi-2012-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. DIP original experiment: DIP-249356X PLoS biology 2012 IMEx Sequential analysis of trans-SNARE formation in intracellular membrane fusion. Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. Only protein-protein interactions imex curation alpadi-2012-10 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. DIP original experiment: DIP-249346X PLoS biology 2012 IMEx Sequential analysis of trans-SNARE formation in intracellular membrane fusion. Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. Only protein-protein interactions imex curation alpadi-2012-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. DIP original experiment: DIP-249350X PLoS biology 2012 IMEx Sequential analysis of trans-SNARE formation in intracellular membrane fusion. Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. Only protein-protein interactions imex curation alpadi-2012-12 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. DIP original experiment: DIP-249347X PLoS biology 2012 IMEx Sequential analysis of trans-SNARE formation in intracellular membrane fusion. Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. Only protein-protein interactions imex curation alpadi-2012-13 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. DIP original experiment: DIP-249351X PLoS biology 2012 IMEx Sequential analysis of trans-SNARE formation in intracellular membrane fusion. Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. Only protein-protein interactions imex curation alpadi-2012-14 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. DIP original experiment: DIP-249354X PLoS biology 2012 IMEx Sequential analysis of trans-SNARE formation in intracellular membrane fusion. Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. Only protein-protein interactions imex curation alpadi-2012-15 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. DIP original experiment: DIP-249358X PLoS biology 2012 IMEx Sequential analysis of trans-SNARE formation in intracellular membrane fusion. Alpadi K., Kulkarni A., Comte V., Reinhardt M., Schmidt A., Namjoshi S., Mayer A., Peters C. Only protein-protein interactions imex curation vam3_yeast Syntaxin VAM3 VAM3 PTH1 YOR106W YOR3220W Vacuolar morphogenesis protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFFDIEAQSSKGNSQQEPQFSTNQKTKELSNLIETFAEQSRVLEKECTKIGSKRDSKELRYKIETELIPNCTSVRDKIESNILIHQNGKLSADFKNLKTKYQSLQQSYNQRKSLFPLKTPISPGTSKERKDIHPRTEAVRQDPESSYISIKVNEQSPLLHNEGQHQLQLQEEQEQQQQGLSQEELDFQTIIHQERSQQIGRIHTAVQEVNAIFHQLGSLVKEQGEQVTTIDENISHLHDNMQNANKQLTRADQHQRDRNKCGKVTLIIIIVVCMVVLLAVLS 6415D9D852C6C64D nyv1_yeast Vacuolar v-SNARE NYV1 NYV1 Synaptobrevin NYV1 New v-SNARE 1 MAM2 YLR093C protein protein yeast Saccharomyces cerevisiae Baker's yeast MKRFNVSYVEVIKNGETISSCFQPFQKNENYGTITSANEQITPVIFHNLIMDMVLPKVVPIKGNKVTKMSMNLIDGFDCFYSTDDHDPKTVYVCFTLVDMPKILPIRILSGLQEYESNATNELLSSHVGQILDSFHEELVEYRNQTLNSSGNGQSSNGNGQNTISDIGDATEDQIKDVIQIMNDNIDKFLERQERVSLLVDKTSQLNSSSNKFRRKAVNIKEIMWWQKVKNITLLTFTIILFVSAAFMFFYLW 494B587CF0F85997 vam6_yeast Vacuolar morphogenesis protein 6 Vacuolar protein sorting-associated protein 39 CVT4 VAM6 VPL18 VPL22 VPS39 YDL077C protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRAQKLHSLKSSDITAILPTEQSQKLVLAKKNGDVEVYSRDGNTLKLFQVYPDLLQNAKNDPLPPVIENFYFANELSTIFAQCKETLILLSTTNLHEYDRIIDRRGINHCWLFERSHKNKEEKNTYLIYSTINTAKMRVLIWEGRTYKNMMEASLSYRKETIRSIYPGETGITLATDLGIYHWPYNKPSLIRIEKTVKNKFPKDMISALTELKEQAEKVIEKKPKKNSHFDAQSFSSMDRMSRKSSMSSLWYRTIRNERGNKIRYTFELDGNDATPMIIDGATKKIFKVELMHNNEEPFLIATDHATFSESNSEFDHMQYLSSNLLMLYNSSTIKFVDYENGFTFLQQKIPEGIKWVKNLSGTYFLVWTSNDEVQLFSYHVDDGSEDDDQESICGDINDPDFYQLWRKVLFYKFFIDSPHSKELCVSDNPEESLDICAMKLRDLTVMWCLRIFDKFQNYMVQLERSRNSRMIRSKCEEMIIKSIFDLFIKFWAPPQLVILKVFPSAISSLVLEITGQEHHCLLKEAEEVKETYDIPPHLLNRWCLPYLTDTRRHLQNLLSKENDDESRITWCYRDREIKQSFDFFLISNHDDVDLNTMLTLIDTVLFKCYLYYNPPMVGPFIRVENHCDSHVIVTELKIRHMFKDLIDFYYKRGNHEEALKFLTDLVDELENDNTDQKQRQKIDHGVKILVIYYLKKLSNPQLDVIFTYTDWLLNRHNDSIKEILSSIFFYDSQACSSRDHLKVYGYIKKFDKLLAIQYLEFAISTFRLEGNKLHTVLIKLYLENLDIPSTRIKLKSLLETTSVYEPRTILKLLNDAIESGSDQLPTNQLNFVKYLKIFPLSKLENHKEAVHILLDEIDDYKAATSYCNDVYQSDSTKGEELLLYLYSKLVSIYDSNRNSKLILNFLQDHGSKLNSAEIYKNLPQDISLYDIGRVVSQLLKKHTSKMDETRLEKALLQVELVATTYKLNERMSSYGVLSDSHKCPICKKVISNFGTDSISWFTREGRNIITHYNCGKVLQERFNAKNEKSSRIKQKTLGEVINELNNK EE8D94E7E2F5F078 vti1_yeast t-SNARE VTI1 VTI1 Qb-SNARE VTI1 Vesicle transport v-SNARE protein VTI1 VPS10-interacting protein 1 YM9646.10C YMR197C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDSGDRDRLFGDLNASNIDDDQRQQLLSNHAILQKSGDRLKDASRIANETEGIGSQIMMDLRSQRETLENARQTLFQADSYVDKSIKTLKTMTRRLVANKFISYAIIAVLILLILLVLFSKFK E55B4DA3B40FAD67 vam7_yeast Vacuolar morphogenesis protein 7 VAM7 YGL212W protein protein yeast Saccharomyces cerevisiae Baker's yeast MAANSVGKMSEKLRIKVDDVKINPKYVLYGVSTPNKRLYKRYSEFWKLKTRLERDVGSTIPYDFPEKPGVLDRRWQRRYDDPEMIDERRIGLERFLNELYNDRFDSRWRDTKIAQDFLQLSKPNVSQEKSQQHLETADEVGWDEMIRDIKLDLDKESDGTPSVRGALRARTKLHKLRERLEQDVQKKSLPSTEVTRRAALLRSLLKECDDIGTANIAQDRGRLLGVATSDNSSTTEVQGRTNNDLQQGQMQMVRDQEQELVALHRIIQAQRGLALEMNEELQTQNELLTALEDDVDNTGRRLQIANKKARHFNNSA 2F992AEC0ACBC8FE vps33_yeast Vacuolar protein sorting-associated protein 33 VPS33 SLP1 Protein SLP1 Vacuolar morphogenesis protein 5 VAM5 L8084.15 YLR396C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNRFWNTKKFSLTNADGLCATLNEISQNDEVLVVQPSVLPVLNSLLTFQDLTQSTPVRKITLLDDQLSDDLPSALGSVPQMDLIFLIDVRTSLRLPPQLLDAAQKHNLSSLHIIYCRWKPSFQNTLEDTEQWQKDGFDLNSKKTHFPNVIESQLKELSNEYTLYPWDLLPFPQIDENVLLTHSLYNMENVNMYYPNLRSLQSATESILVDDMVNSLQSLIFETNSIITNVVSIGNLSKRCSHLLKKRIDEHQTENDLFIKGTLYGERTNCGLEMDLIILERNTDPITPLLTQLTYAGILDDLYEFNSGIKIKEKDMNFNYKEDKIWNDLKFLNFGSIGPQLNKLAKELQTQYDTRHKAESVHEIKEFVDSLGSLQQRQAFLKNHTTLSSDVLKVVETEEYGSFNKILELELEILMGNTLNNDIEDIILELQYQYEVDQKKILRLICLLSLCKNSLREKDYEYLRTFMIDSWGIEKCFQLESLAELGFFTSKTGKTDLHITTSKSTRLQKEYRYISQWFNTVPIEDEHAADKITNENDDFSEATFAYSGVVPLTMRLVQMLYDRSILFHNYSSQQPFILSREPRVSQTEDLIEQLYGDSHAIEESIWVPGTITKKINASIKSNNRRSIDGSNGTFHAAEDIALVVFLGGVTMGEIAIMKHLQKILGKKGINKRFIIIADGLINGTRIMNSIS ED78DF55109C20E7 nyv1-vam3-2 3235721 N/A 3235736 unspecified role unspecified role prey prey VSV-tag VSV-tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235737 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false nyv1-vam7-2 3235722 N/A 3235738 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235737 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235739 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235740 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false nyv1-vti1-1 3235723 N/A 3235739 unspecified role unspecified role prey prey VSV-tag VSV-tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235737 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false nyv1-vam7-3 3235724 N/A 3235737 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235739 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235740 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false nyv1-vam7-4 3235725 N/A 3235737 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235739 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235740 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false vam3-nyv1-5 3235726 N/A 3235736 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235737 unspecified role unspecified role prey prey VSV-tag VSV-tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false vam3-vti1-1 3235727 N/A 3235736 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235739 unspecified role unspecified role prey prey VSV-tag VSV-tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false nyv1-vam3-3 3235728 N/A 3235740 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235736 unspecified role unspecified role prey prey VSV-tag VSV-tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235737 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false vps33-vam7-1 3235729 N/A 3235741 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235740 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false nyv1-vam7-5 3235730 N/A 3235740 unspecified role unspecified role prey prey VSV-tag VSV-tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235737 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false vam3-nyv1-6 3235731 N/A 3235737 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235739 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235740 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235736 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false vam3-vam7-4 3235732 N/A 3235736 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235740 unspecified role unspecified role prey prey VSV-tag VSV-tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false nyv1-vam3-4 3235733 N/A 3235737 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235739 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235740 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235736 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false nyv1-vam7-6 3235734 N/A 3235740 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235737 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false nyv1-vam7-7 3235735 N/A 3235737 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235739 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3235740 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false