DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dou-2012-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dou H., Buetow L., Hock A., Sibbet GJ., Vousden KH., Huang DT. DIP original experiment: DIP-250779X Nature structural & molecular biology 2012 IMEx Structural basis for autoinhibition and phosphorylation-dependent activation of c-Cbl. Dou H., Buetow L., Hock A., Sibbet GJ., Vousden KH., Huang DT. Only protein-protein interactions imex curation dou-2012-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dou H., Buetow L., Hock A., Sibbet GJ., Vousden KH., Huang DT. DIP original experiment: DIP-250781X Nature structural & molecular biology 2012 IMEx Structural basis for autoinhibition and phosphorylation-dependent activation of c-Cbl. Dou H., Buetow L., Hock A., Sibbet GJ., Vousden KH., Huang DT. Only protein-protein interactions imex curation dou-2012-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Dou H., Buetow L., Hock A., Sibbet GJ., Vousden KH., Huang DT. DIP original experiment: DIP-250783X Nature structural & molecular biology 2012 IMEx Structural basis for autoinhibition and phosphorylation-dependent activation of c-Cbl. Dou H., Buetow L., Hock A., Sibbet GJ., Vousden KH., Huang DT. Only protein-protein interactions imex curation dou-2012-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dou H., Buetow L., Hock A., Sibbet GJ., Vousden KH., Huang DT. DIP original experiment: DIP-250780X Nature structural & molecular biology 2012 IMEx Structural basis for autoinhibition and phosphorylation-dependent activation of c-Cbl. Dou H., Buetow L., Hock A., Sibbet GJ., Vousden KH., Huang DT. Only protein-protein interactions imex curation dou-2012-5 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Dou H., Buetow L., Hock A., Sibbet GJ., Vousden KH., Huang DT. DIP original experiment: DIP-250782X Nature structural & molecular biology 2012 IMEx Structural basis for autoinhibition and phosphorylation-dependent activation of c-Cbl. Dou H., Buetow L., Hock A., Sibbet GJ., Vousden KH., Huang DT. Only protein-protein interactions imex curation dou-2012-6 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Dou H., Buetow L., Hock A., Sibbet GJ., Vousden KH., Huang DT. DIP original experiment: DIP-250784X Nature structural & molecular biology 2012 IMEx Structural basis for autoinhibition and phosphorylation-dependent activation of c-Cbl. Dou H., Buetow L., Hock A., Sibbet GJ., Vousden KH., Huang DT. Only protein-protein interactions imex curation zap70_human Tyrosine-protein kinase ZAP-70 ZAP70 SRK Syk-related tyrosine kinase 70 kDa zeta-chain associated protein protein protein human Homo sapiens Human MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGPPGSTQKAEAACA cbl_human E3 ubiquitin-protein ligase CBL Signal transduction protein CBL Proto-oncogene c-Cbl Casitas B-lineage lymphoma proto-oncogene RING finger protein 55 CBL CBL2 RNF55 RING-type E3 ubiquitin transferase CBL protein protein human Homo sapiens Human MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVERPPSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTLRDLPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPVSAPSSSDPWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSMSMNSSPLVGPECDHPKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRACDCDQQIDSCTYEAMYNIQSQAPSITESSTFGEGNLAAAHANTGPEESENEDDGYDVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVAT ub2d2_human Ubiquitin-conjugating enzyme E2 D2 UBC5B UBCH4 UBE2D2 UBC4 UBCH5B Ubiquitin-protein ligase D2 Ubiquitin carrier protein D2 Ubiquitin-conjugating enzyme E2-17 kDa 2 Ubiquitin-conjugating enzyme E2(17)KB 2 PUBC1 p53-regulated ubiquitin-conjugating enzyme 1 (E3-independent) E2 ubiquitin-conjugating enzyme D2 E2 ubiquitin-conjugating enzyme D2 protein protein human Homo sapiens Human MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM cbl-zap70-1 3235540 N/A 3235546 unspecified role unspecified role unspecified role unspecified role Region 286-297 Region 286-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3235547 unspecified role unspecified role unspecified role unspecified role Region 47-435 Region 47-435 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cbl-ube2d2-1 3235541 N/A 3235548 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3235547 unspecified role unspecified role unspecified role unspecified role Region 354-435 Region 354-435 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cbl-zap70-2 3235542 N/A 3235546 unspecified role unspecified role prey prey Region 286-297 Region 286-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3235547 unspecified role unspecified role bait bait Region 47-435 Region 47-435 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false cbl-ube2d2-2 3235543 N/A 3235548 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3235546 unspecified role unspecified role unspecified role unspecified role Region 286-297 Region 286-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3235547 unspecified role unspecified role unspecified role unspecified role Region 47-435 Region 47-435 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false cbl-ube2d2-3 3235544 N/A 3235548 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3235547 unspecified role unspecified role bait bait Region 354-435 Region 354-435 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P22681:p.Met222Glu M222E mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P22681:p.Tyr368Phe Y368F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false pY371 pY371 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cbl-ube2d2-4 3235545 N/A 3235548 unspecified role unspecified role prey prey P62837:p.Lys4Ala K4A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3235547 unspecified role unspecified role bait bait Region 354-435 Region 354-435 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false