DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ malet-2012-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Malet H., Canellas F., Sawa J., Yan J., Thalassinos K., Ehrmann M., Clausen T., Saibil HR. DIP original experiment: DIP-250767X Nature structural & molecular biology 2012 IMEx Newly folded substrates inside the molecular cage of the HtrA chaperone DegQ. Malet H., Canellas F., Sawa J., Yan J., Thalassinos K., Ehrmann M., Clausen T., Saibil HR. Only protein-protein interactions imex curation malet-2012-2 in vitro In vitro protein folding protein folding/unfolding protein folding predetermined predetermined participant predetermined Malet H., Canellas F., Sawa J., Yan J., Thalassinos K., Ehrmann M., Clausen T., Saibil HR. DIP original experiment: DIP-250771X Nature structural & molecular biology 2012 IMEx Newly folded substrates inside the molecular cage of the HtrA chaperone DegQ. Malet H., Canellas F., Sawa J., Yan J., Thalassinos K., Ehrmann M., Clausen T., Saibil HR. Only protein-protein interactions imex curation malet-2012-3 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Malet H., Canellas F., Sawa J., Yan J., Thalassinos K., Ehrmann M., Clausen T., Saibil HR. DIP original experiment: DIP-250768X Nature structural & molecular biology 2012 IMEx Newly folded substrates inside the molecular cage of the HtrA chaperone DegQ. Malet H., Canellas F., Sawa J., Yan J., Thalassinos K., Ehrmann M., Clausen T., Saibil HR. Only protein-protein interactions imex curation malet-2012-4 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Malet H., Canellas F., Sawa J., Yan J., Thalassinos K., Ehrmann M., Clausen T., Saibil HR. DIP original experiment: DIP-250769X Nature structural & molecular biology 2012 IMEx Newly folded substrates inside the molecular cage of the HtrA chaperone DegQ. Malet H., Canellas F., Sawa J., Yan J., Thalassinos K., Ehrmann M., Clausen T., Saibil HR. Only protein-protein interactions imex curation malet-2012-5 in vitro In vitro protein folding protein folding/unfolding protein folding predetermined predetermined participant predetermined Malet H., Canellas F., Sawa J., Yan J., Thalassinos K., Ehrmann M., Clausen T., Saibil HR. DIP original experiment: DIP-250770X Nature structural & molecular biology 2012 IMEx Newly folded substrates inside the molecular cage of the HtrA chaperone DegQ. Malet H., Canellas F., Sawa J., Yan J., Thalassinos K., Ehrmann M., Clausen T., Saibil HR. Only protein-protein interactions imex curation degq_ecoli Periplasmic pH-dependent serine endoprotease DegQ degQ hhoA b3234 JW3203 Protease Do protein protein ecoli Escherichia coli (strain K12) MKKQTQLLSALALSVGLTLSASFQAVASIPGQVADQAPLPSLAPMLEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIINASKGYVLTNNHVINQAQKISIQLNDGREFDAKLIGSDDQSDIALLQIQNPSKLTQIAIADSDKLRVGDFAVAVGNPFGLGQTATSGIVSALGRSGLNLEGLENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLIDFGEIKRGLLGIKGTEMSADIAKAFNLDVQRGAFVSEVLPGSGSAKAGVKAGDIITSLNGKPLNSFAELRSRIATTEPGTKVKLGLLRNGKPLEVEVTLDTSTSSSASAEMITPALEGATLSDGQLKDGGKGIKIDEVVKGSPAAQAGLQKDDVIIGVNRDRVNSIAEMRKVLAAKPAIIALQIVRGNESIYLLMR degp_ecoli Periplasmic serine endoprotease DegP degP htrA ptd b0161 JW0157 Heat shock protein DegP Protease Do protein protein ecoli Escherichia coli (strain K12) MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ amy1_ecoli Periplasmic alpha-amylase 1,4-alpha-D-glucan glucanohydrolase malS b3571 JW3543 protein protein ecoli Escherichia coli (strain K12) MKLAACFLTLLPGFAVAASWTSPGFPAFSEQGTGTFVSHAQLPKGTRPLTLNFDQQCWQPADAIKLNQMLSLQPCSNTPPQWRLFRDGEYTLQIDTRSGTPTLMISIQNAAEPVASLVRECPKWDGLPLTVDVSATFPEGAAVRDYYSQQIAIVKNGQIMLQPAATSNGLLLLERAETDTSAPFDWHNATVYFVLTDRFENGDPSNDQSYGRHKDGMAEIGTFHGGDLRGLTNKLDYLQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIRILFDVVMNHTGYATLADMQEYQFGALYLSGDEVKKSLGERWSDWKPAAGQTWHSFNDYINFSDKTGWDKWWGKNWIRTDIGDYDNPGFDDLTMSLAFLPDIKTESTTASGLPVFYKNKMDTHAKAIDGYTPRDYLTHWLSQWVRDYGIDGFRVDTAKHVELPAWQQLKTEASAALREWKKANPDKALDDKPFWMTGEAWGHGVMQSDYYRHGFDAMINFDYQEQAAKAVDCLAQMDTTWQQMAEKLQGFNVLSYLSSHDTRLFREGGDKAAELLLLAPGAVQIFYGDESSRPFGPTGSDPLQGTRSDMNWQDVSGKSAASVAHWQKISQFRARHPAIGAGKQTTLLLKQGYGFVREHGDDKVLVVWAGQQ degq-4 3235279 N/A 3235284 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false degp-mals-1 3235280 N/A 3235285 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3235286 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false degq-5 3235281 N/A 3235284 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false degq-6 3235282 N/A 3235284 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false degq-mals-1 3235283 N/A 3235286 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3235284 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false