DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kalinina-2012-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kalinina J., Dutta K., Ilghari D., Beenken A., Goetz R., Eliseenkova AV., Cowburn D., Mohammadi M. DIP original experiment: DIP-249239X Structure (London, England : 1993) 2012 IMEx The alternatively spliced acid box region plays a key role in FGF receptor autoinhibition. Kalinina J., Dutta K., Ilghari D., Beenken A., Goetz R., Eliseenkova AV., Cowburn D., Mohammadi M. Only protein-protein interactions imex curation kalinina-2012-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kalinina J., Dutta K., Ilghari D., Beenken A., Goetz R., Eliseenkova AV., Cowburn D., Mohammadi M. DIP original experiment: DIP-249241X Structure (London, England : 1993) 2012 IMEx The alternatively spliced acid box region plays a key role in FGF receptor autoinhibition. Kalinina J., Dutta K., Ilghari D., Beenken A., Goetz R., Eliseenkova AV., Cowburn D., Mohammadi M. Only protein-protein interactions imex curation kalinina-2012-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kalinina J., Dutta K., Ilghari D., Beenken A., Goetz R., Eliseenkova AV., Cowburn D., Mohammadi M. DIP original experiment: DIP-249240X Structure (London, England : 1993) 2012 IMEx The alternatively spliced acid box region plays a key role in FGF receptor autoinhibition. Kalinina J., Dutta K., Ilghari D., Beenken A., Goetz R., Eliseenkova AV., Cowburn D., Mohammadi M. Only protein-protein interactions imex curation kalinina-2012-4 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kalinina J., Dutta K., Ilghari D., Beenken A., Goetz R., Eliseenkova AV., Cowburn D., Mohammadi M. DIP original experiment: DIP-249242X Structure (London, England : 1993) 2012 IMEx The alternatively spliced acid box region plays a key role in FGF receptor autoinhibition. Kalinina J., Dutta K., Ilghari D., Beenken A., Goetz R., Eliseenkova AV., Cowburn D., Mohammadi M. Only protein-protein interactions imex curation fgfr3_human Fibroblast growth factor receptor 3 FGFR3 JTK4 protein protein human Homo sapiens Human MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT p05230-1 Fibroblast growth factor 1 Acidic fibroblast growth factor Endothelial cell growth factor Heparin-binding growth factor 1 FGF1 FGFA protein protein human Homo sapiens Human MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD fgfr1_human Fibroblast growth factor receptor 1 FGFR1 FGFBR FLG FLT2 Fms-like tyrosine kinase 2 Proto-oncogene c-Fgr BFGFR CEK HBGFR Basic fibroblast growth factor receptor 1 N-sam protein protein human Homo sapiens Human MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR p55075-4 Fibroblast growth factor 8 FGF8 AIGF Androgen-induced growth factor Heparin-binding growth factor 8 protein protein human Homo sapiens Human MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR fgf1-fgfr3-1 3235127 N/A 3235131 unspecified role unspecified role prey prey Region 33-365 Region 33-365 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Region 133-143 Region 133-143 binding region binding-associated region binding region alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3235132 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false Deletion of region 127-148 increased the interaction rate/strength. fgf1-fgfr1-1 3235128 N/A 3235133 unspecified role unspecified role prey prey Region 116-365 Region 116-365 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 126-138 Region 126-138 binding region binding-associated region binding region alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3235132 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false Deletion of region 126-138 increased the interaction rate/strength. fgf8-fgfr3-1 3235129 N/A 3235134 unspecified role unspecified role bait bait Region 23-215 Region 23-215 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3235131 unspecified role unspecified role prey prey Region 33-365 Region 33-365 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Region 133-143 Region 133-143 binding region binding-associated region binding region alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false Deletion of region 127-148 increased the interaction rate/strength. fgf8-fgfr1-1 3235130 N/A 3235134 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3235133 unspecified role unspecified role prey prey Region 126-138 Region 126-138 binding region binding-associated region binding region alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Region 21-365 Region 21-365 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false Deletion of region 126-138 increased the interaction rate/strength.