DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bebeacua-2012-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bebeacua C., Förster A., McKeown C., Meyer HH., Zhang X., Freemont PS. DIP original experiment: DIP-251475X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Distinct conformations of the protein complex p97-Ufd1-Npl4 revealed by electron cryomicroscopy. Bebeacua C., Förster A., McKeown C., Meyer HH., Zhang X., Freemont PS. Only protein-protein interactions imex curation bebeacua-2012-2 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Bebeacua C., Förster A., McKeown C., Meyer HH., Zhang X., Freemont PS. DIP original experiment: DIP-251478X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Distinct conformations of the protein complex p97-Ufd1-Npl4 revealed by electron cryomicroscopy. Bebeacua C., Förster A., McKeown C., Meyer HH., Zhang X., Freemont PS. Only protein-protein interactions imex curation bebeacua-2012-3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Bebeacua C., Förster A., McKeown C., Meyer HH., Zhang X., Freemont PS. DIP original experiment: DIP-251480X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Distinct conformations of the protein complex p97-Ufd1-Npl4 revealed by electron cryomicroscopy. Bebeacua C., Förster A., McKeown C., Meyer HH., Zhang X., Freemont PS. Only protein-protein interactions imex curation bebeacua-2012-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bebeacua C., Förster A., McKeown C., Meyer HH., Zhang X., Freemont PS. DIP original experiment: DIP-251476X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Distinct conformations of the protein complex p97-Ufd1-Npl4 revealed by electron cryomicroscopy. Bebeacua C., Förster A., McKeown C., Meyer HH., Zhang X., Freemont PS. Only protein-protein interactions imex curation bebeacua-2012-5 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Bebeacua C., Förster A., McKeown C., Meyer HH., Zhang X., Freemont PS. DIP original experiment: DIP-251481X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Distinct conformations of the protein complex p97-Ufd1-Npl4 revealed by electron cryomicroscopy. Bebeacua C., Förster A., McKeown C., Meyer HH., Zhang X., Freemont PS. Only protein-protein interactions imex curation bebeacua-2012-6 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Bebeacua C., Förster A., McKeown C., Meyer HH., Zhang X., Freemont PS. DIP original experiment: DIP-251479X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Distinct conformations of the protein complex p97-Ufd1-Npl4 revealed by electron cryomicroscopy. Bebeacua C., Förster A., McKeown C., Meyer HH., Zhang X., Freemont PS. Only protein-protein interactions imex curation bebeacua-2012-7 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Bebeacua C., Förster A., McKeown C., Meyer HH., Zhang X., Freemont PS. DIP original experiment: DIP-251477X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Distinct conformations of the protein complex p97-Ufd1-Npl4 revealed by electron cryomicroscopy. Bebeacua C., Förster A., McKeown C., Meyer HH., Zhang X., Freemont PS. Only protein-protein interactions imex curation ufd1_mouse Ubiquitin recognition factor in ER-associated degradation protein 1 Ufd1 Ubiquitin fusion degradation protein 1 homolog Ufd1l protein protein mouse Mus musculus Mouse MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFIAFSGEGQSLRKKGRKP mint homomint Essential component of the ubiquitin-dependent proteolytic pathway which degrades ubiquitin fusion proteins. The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope (By similarity). It may be involved in the development of some ectoderm-derived structures npl4_rat Nuclear protein localization protein 4 homolog Nploc4 Npl4 protein protein rat Rattus norvegicus (Rat) Rat MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSSKSLHLLKIKHGDLLFLFPSSLAGPSSEMETSTSVGLKAFGAPHVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKAEVVDEIASKLGLRKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSSEECITAGDFQNKHPNICRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVRTRNEELAQTWKKSEQWATIEQLCSTVGVQLPGLHEFGAVGGSARAATSAMWACQHCTFMNQPGTGHCEMCSLPRT tera_mouse Transitional endoplasmic reticulum ATPase Vcp 15S Mg(2+)-ATPase p97 subunit Valosin-containing protein protein protein mouse Mus musculus Mouse MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG nploc4-ufd1l-12 3235009 N/A 3235016 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3235017 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3235018 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false nploc4-ufd1l-13 3235010 N/A 3235016 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3235017 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ufd1l-nploc4-9 3235011 N/A 3235016 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3235017 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3235018 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false nploc4-ufd1l-14 3235012 N/A 3235016 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3235017 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false vcp-7 3235013 N/A 3235018 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false nploc4-ufd1l-15 3235014 N/A 3235016 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3235017 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3235018 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false nploc4-ufd1l-16 3235015 N/A 3235016 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3235017 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3235018 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false