DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bttner-2012-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Büttner CR., Chechik M., Ortiz-Lombardía M., Smits C., Ebong IO., Chechik V., Jeschke G., Dykeman E., Benini S., Robinson CV., Alonso JC., Antson AA. DIP original experiment: DIP-251466X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structural basis for DNA recognition and loading into a viral packaging motor. Büttner CR., Chechik M., Ortiz-Lombardía M., Smits C., Ebong IO., Chechik V., Jeschke G., Dykeman E., Benini S., Robinson CV., Alonso JC., Antson AA. Only protein-protein interactions imex curation bttner-2012-2 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Büttner CR., Chechik M., Ortiz-Lombardía M., Smits C., Ebong IO., Chechik V., Jeschke G., Dykeman E., Benini S., Robinson CV., Alonso JC., Antson AA. DIP original experiment: DIP-251470X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structural basis for DNA recognition and loading into a viral packaging motor. Büttner CR., Chechik M., Ortiz-Lombardía M., Smits C., Ebong IO., Chechik V., Jeschke G., Dykeman E., Benini S., Robinson CV., Alonso JC., Antson AA. Only protein-protein interactions imex curation bttner-2012-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Büttner CR., Chechik M., Ortiz-Lombardía M., Smits C., Ebong IO., Chechik V., Jeschke G., Dykeman E., Benini S., Robinson CV., Alonso JC., Antson AA. DIP original experiment: DIP-251467X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structural basis for DNA recognition and loading into a viral packaging motor. Büttner CR., Chechik M., Ortiz-Lombardía M., Smits C., Ebong IO., Chechik V., Jeschke G., Dykeman E., Benini S., Robinson CV., Alonso JC., Antson AA. Only protein-protein interactions imex curation bttner-2012-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Büttner CR., Chechik M., Ortiz-Lombardía M., Smits C., Ebong IO., Chechik V., Jeschke G., Dykeman E., Benini S., Robinson CV., Alonso JC., Antson AA. DIP original experiment: DIP-251468X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structural basis for DNA recognition and loading into a viral packaging motor. Büttner CR., Chechik M., Ortiz-Lombardía M., Smits C., Ebong IO., Chechik V., Jeschke G., Dykeman E., Benini S., Robinson CV., Alonso JC., Antson AA. Only protein-protein interactions imex curation bttner-2012-5 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Büttner CR., Chechik M., Ortiz-Lombardía M., Smits C., Ebong IO., Chechik V., Jeschke G., Dykeman E., Benini S., Robinson CV., Alonso JC., Antson AA. DIP original experiment: DIP-251469X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structural basis for DNA recognition and loading into a viral packaging motor. Büttner CR., Chechik M., Ortiz-Lombardía M., Smits C., Ebong IO., Chechik V., Jeschke G., Dykeman E., Benini S., Robinson CV., Alonso JC., Antson AA. Only protein-protein interactions imex curation ters_bpsf6 Terminase small subunit 1 G1P Terminase, small subunit protein protein bpsf6 Bacillus phage SF6 Bacteriophage SF6 MKEPKLSPKQERFIEEYFINDMNATKAAIAAGYSKNSASAIGAENLQKPAIRARIDARLKEINEKKILQANEVLEHLTRIALGQEKEQVLMGIGKGAETKTHVEVSAKDRIKALELLGKAHAVFTDKQKVETNQVIIVDDSGDAE This sequence has been withdrawn from Uniprot. 85C811F726AAEE59 g1p-1 3234700 N/A 3234705 unspecified role unspecified role unspecified role unspecified role Region 53-120 Region 53-120 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false g1p-2 3234701 N/A 3234705 unspecified role unspecified role unspecified role unspecified role Region 53-145 Region 53-145 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false g1p-3 3234702 N/A 3234705 unspecified role unspecified role unspecified role unspecified role Region 65-141 Region 65-141 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false g1p-4 3234703 N/A 3234705 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false g1p-5 3234704 N/A 3234705 unspecified role unspecified role unspecified role unspecified role Region 1-120 Region 1-120 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false